Сравнение
Buserelin vs. FOXO4-DRI
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
57982-77-1
2074706-72-8
Молекулярная масса
1239.42 g/mol
3735 g/mol
Период полувыведения
нет данных
0.5 h
Последовательность
нет данных
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Механизм действия
Buserelin
Buserelin is a potent GnRH agonist: after an initial stimulatory surge ('flare'), continuous receptor occupancy causes downregulation and thereby suppression of LH, FSH and the downstream sex hormones.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Доказательная база
Наивысшая доказательность
РКИ на людях
Модель на животных
Исследования
0
3
из них на людях
0
0
Зафиксированные эффекты
2
3
Открытые противоречия
0
1
Задокументированные нежелательные явления
1
1
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Buserelin and FOXO4-DRI?
- Buserelin is classified as "Исследования (прочее)", while FOXO4-DRI is classified as "Исследования (прочее)". Buserelin: Buserelin is a synthetic GnRH agonist (including as a nasal spray). It is used in endometriosis, hormone-dependent prostate cancer and assisted reproduction; approved in Europe (Suprefact), not in the US. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Buserelin or FOXO4-DRI?
- The highest available evidence level is "РКИ на людях" for Buserelin and "Модель на животных" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Buserelin and FOXO4-DRI in Germany and the United States?
- Германия: Buserelin — Рецептурный, FOXO4-DRI — Только для исследований. США: Buserelin — Не одобрено, FOXO4-DRI — Только для исследований. These are factual summaries with source and review date on the individual pages.