Сравнение
Calcitonin (Lachs) vs. LL-37
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
47931-85-1
597562-32-8
Молекулярная масса
3431.85 g/mol
4493.33 g/mol
Период полувыведения
1 h
нет данных
Последовательность
Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2[LL-37, 37 aa]Механизм действия
Calcitonin (Lachs)
Salmon calcitonin binds the calcitonin receptor, which is particularly densely expressed on bone-resorbing osteoclasts. The literature describes that receptor activation inhibits osteoclast activity and motility, thereby reducing bone resorption. This results in reduced release of calcium and phosphate from bone into the blood, which is regarded as the mechanistic basis for the calcium-lowering effect. The salmon variant binds the receptor more strongly and for longer than human calcitonin, which explains its higher potency. Central nervous system mechanisms are additionally discussed in relation to its pain effect in fractures, the basis of which is regarded in the literature as not fully elucidated.
LL-37
LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.
Доказательная база
Наивысшая доказательность
РКИ на людях
Исследование на людях
Исследования
4
4
из них на людях
4
1
Зафиксированные эффекты
4
4
Открытые противоречия
1
1
Задокументированные нежелательные явления
2
0
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Calcitonin (Lachs) and LL-37?
- Calcitonin (Lachs) is classified as "Исследования (прочее)", while LL-37 is classified as "Исследования (прочее)". Calcitonin (Lachs): Salmon calcitonin is a synthetically produced 32-amino-acid peptide hormone that corresponds to the body's own calcitonin but exhibits higher biological potency than the human hormone. In the scientific literature it is studied in the context of inhibiting osteoclast-mediated bone resorption and lowering elevated calcium levels. It was historically broadly approved for the treatment of postmenopausal osteoporosis; following European safety reviews, however, its use was restricted. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Calcitonin (Lachs) or LL-37?
- The highest available evidence level is "РКИ на людях" for Calcitonin (Lachs) and "Исследование на людях" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Calcitonin (Lachs) and LL-37 in Germany and the United States?
- Германия: Calcitonin (Lachs) — Рецептурный, LL-37 — Только для исследований. США: Calcitonin (Lachs) — Рецептурный, LL-37 — Только для исследований. These are factual summaries with source and review date on the individual pages.