Сравнение
Desmopressin vs. LL-37
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
16679-58-6
597562-32-8
Молекулярная масса
1069.2 g/mol
4493.33 g/mol
Период полувыведения
3 h
нет данных
Последовательность
Mpa-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2 (Disulfid 1-6)[LL-37, 37 aa]Механизм действия
Desmopressin
Desmopressin is a structurally modified analogue of the nine-residue peptide hormone vasopressin. Deamination at the N-terminus (1-deamino) and replacement of L-arginine by D-arginine at position 8 prolong the duration of action and render the compound largely selective for the vasopressin V2 receptor, while the V1-mediated vasoconstrictive effect is strongly reduced. Acting on V2 receptors in the renal collecting ducts, it promotes insertion of aquaporin-2 water channels into the apical membrane, increasing water reabsorption and reducing urine volume (antidiuretic effect). In addition, via V2 receptors on the vascular endothelium, desmopressin stimulates the release of von Willebrand factor and factor VIII from endothelial stores (Weibel-Palade bodies), improving primary haemostasis.
LL-37
LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.
Доказательная база
Наивысшая доказательность
РКИ на людях
Исследование на людях
Исследования
4
4
из них на людях
4
1
Зафиксированные эффекты
4
4
Открытые противоречия
1
1
Задокументированные нежелательные явления
2
0
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Desmopressin and LL-37?
- Desmopressin is classified as "Исследования (прочее)", while LL-37 is classified as "Исследования (прочее)". Desmopressin: Desmopressin (DDAVP) is a synthetic analogue of the endogenous hormone vasopressin (antidiuretic hormone, ADH). Deamination of the first amino acid and substitution of L-arginine with D-arginine give it selective activity at the V2 receptor with strongly reduced pressor (V1) activity. It has been approved for decades for indications including central diabetes insipidus, primary nocturnal enuresis, and bleeding tendency in von Willebrand disease type 1 and mild haemophilia A. The principal safety concern is hyponatremia or water intoxication. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Desmopressin or LL-37?
- The highest available evidence level is "РКИ на людях" for Desmopressin and "Исследование на людях" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Desmopressin and LL-37 in Germany and the United States?
- Германия: Desmopressin — Рецептурный, LL-37 — Только для исследований. США: Desmopressin — Рецептурный, LL-37 — Только для исследований. These are factual summaries with source and review date on the individual pages.