Сравнение

Eloralintide vs. Liraglutide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

нет данных

204656-20-2

Молекулярная масса

нет данных

3751 g/mol

Период полувыведения

нет данных

13 h

Последовательность

нет данных

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

Механизм действия

Eloralintide

Eloralintide selectively activates amylin receptors (preferentially AMY1R) and promotes satiety. The approach targets weight loss via the amylin axis, complementary to or independent of GLP-1 agents.

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Eloralintide	Liraglutide
Германия	Не одобрено	Рецептурный
США	Не одобрено	Рецептурный

Полные записи

Frequently asked questions

What is the difference between Eloralintide and Liraglutide?: Eloralintide is classified as "Метаболизм", while Liraglutide is classified as "Метаболизм". Eloralintide: Eloralintide is a selective, long-acting amylin receptor agonist from Eli Lilly for once-weekly subcutaneous use — under investigation for obesity, alone and combined with incretin therapy. Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Eloralintide or Liraglutide?: The highest available evidence level is "РКИ на людях" for Eloralintide and "РКИ на людях" for Liraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Eloralintide and Liraglutide in Germany and the United States?: Германия: Eloralintide — Не одобрено, Liraglutide — Рецептурный. США: Eloralintide — Не одобрено, Liraglutide — Рецептурный. These are factual summaries with source and review date on the individual pages.

Country

Eloralintide

Liraglutide

Германия

Не одобрено

Рецептурный

США

Не одобрено

Рецептурный

Frequently asked questions

What is the difference between Eloralintide and Liraglutide?

Eloralintide is classified as "Метаболизм", while Liraglutide is classified as "Метаболизм". Eloralintide: Eloralintide is a selective, long-acting amylin receptor agonist from Eli Lilly for once-weekly subcutaneous use — under investigation for obesity, alone and combined with incretin therapy. Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Eloralintide or Liraglutide?

The highest available evidence level is "РКИ на людях" for Eloralintide and "РКИ на людях" for Liraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Eloralintide and Liraglutide in Germany and the United States?

Германия: Eloralintide — Не одобрено, Liraglutide — Рецептурный. США: Eloralintide — Не одобрено, Liraglutide — Рецептурный. These are factual summaries with source and review date on the individual pages.