Сравнение
Epitalon vs. FOXO4-DRI
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
307297-39-8
2074706-72-8
Молекулярная масса
390.35 g/mol
3735 g/mol
Период полувыведения
0.3 h
0.5 h
Последовательность
Ala-Glu-Asp-GlyD-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Механизм действия
Epitalon
Postulated mechanisms include modulation of gene expression in pinealocytes, telomerase activation (observed in cell culture studies) and influence on melatonin synthesis. A defined primary receptor is not established; the mechanistic basis rests on in-vitro and animal data from the Khavinson group.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Доказательная база
Наивысшая доказательность
Исследование на людях
Модель на животных
Исследования
4
3
из них на людях
1
0
Зафиксированные эффекты
4
3
Открытые противоречия
1
1
Задокументированные нежелательные явления
1
1
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Epitalon and FOXO4-DRI?
- Epitalon is classified as "Исследования (прочее)", while FOXO4-DRI is classified as "Исследования (прочее)". Epitalon: Synthetic tetrapeptide (Ala-Glu-Asp-Gly) derived from the pineal extract epithalamin (V. Khavinson, St. Petersburg). Investigated in the Russian research and anti-ageing context; Western controlled trials are largely absent. No medicines approval in EU or US. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Epitalon or FOXO4-DRI?
- The highest available evidence level is "Исследование на людях" for Epitalon and "Модель на животных" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Epitalon and FOXO4-DRI in Germany and the United States?
- Германия: Epitalon — Не одобрено, FOXO4-DRI — Только для исследований. США: Epitalon — Не одобрено, FOXO4-DRI — Только для исследований. These are factual summaries with source and review date on the individual pages.