Сравнение
FOXO4-DRI vs. Gonadorelin
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
2074706-72-8
33515-09-2
Молекулярная масса
3735 g/mol
1182.29 g/mol
Период полувыведения
0.5 h
0.1 h
Последовательность
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2Механизм действия
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Gonadorelin
Gonadorelin acts as an agonist at the GnRH receptor on the gonadotroph cells of the pituitary and triggers release of the gonadotropins luteinizing hormone (LH) and follicle-stimulating hormone (FSH). The temporal pattern of receptor exposure is decisive: pulsatile administration mimics the natural hypothalamic secretory rhythm and sustains LH/FSH release, whereas continuous exposure leads to receptor internalisation and desensitisation with subsequent paradoxical suppression of gonadotropins. The latter principle is exploited therapeutically by longer-acting GnRH agonists.
Доказательная база
Наивысшая доказательность
Модель на животных
Исследование на людях
Исследования
3
4
из них на людях
0
4
Зафиксированные эффекты
3
4
Открытые противоречия
1
1
Задокументированные нежелательные явления
1
2
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between FOXO4-DRI and Gonadorelin?
- FOXO4-DRI is classified as "Исследования (прочее)", while Gonadorelin is classified as "Исследования (прочее)". FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. Gonadorelin: Gonadorelin is the synthetic decapeptide with an amino-acid sequence identical to endogenous gonadotropin-releasing hormone (GnRH/LHRH). Historically approved in several countries for diagnostic testing of pituitary function and for fertility indications (pump systems). A defining feature is the opposite effect of pulsatile versus continuous administration: pulsatile stimulates, continuous leads to receptor desensitisation. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, FOXO4-DRI or Gonadorelin?
- The highest available evidence level is "Модель на животных" for FOXO4-DRI and "Исследование на людях" for Gonadorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of FOXO4-DRI and Gonadorelin in Germany and the United States?
- Германия: FOXO4-DRI — Только для исследований, Gonadorelin — Рецептурный. США: FOXO4-DRI — Только для исследований, Gonadorelin — Рецептурный. These are factual summaries with source and review date on the individual pages.