Сравнение
FOXO4-DRI vs. Lanreotid
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
2074706-72-8
108736-35-2
Молекулярная масса
3735 g/mol
1096.34 g/mol
Период полувыведения
0.5 h
нет данных
Последовательность
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)нет данных
Механизм действия
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Lanreotid
Lanreotide activates somatostatin receptors (chiefly SSTR2, additionally SSTR5), thereby suppressing the release of growth hormone, IGF-1 and various gastrointestinal and neuroendocrine hormones. It is metabolically far more stable than natural somatostatin.
Доказательная база
Наивысшая доказательность
Модель на животных
РКИ на людях
Исследования
3
1
из них на людях
0
1
Зафиксированные эффекты
3
2
Открытые противоречия
1
1
Задокументированные нежелательные явления
1
2
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between FOXO4-DRI and Lanreotid?
- FOXO4-DRI is classified as "Исследования (прочее)", while Lanreotid is classified as "Исследования (прочее)". FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. Lanreotid: Lanreotide is a synthetic cyclic octapeptide analog of somatostatin. It binds preferentially to the somatostatin receptors SSTR2 and SSTR5 and is approved for treating acromegaly and certain neuroendocrine tumours. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, FOXO4-DRI or Lanreotid?
- The highest available evidence level is "Модель на животных" for FOXO4-DRI and "РКИ на людях" for Lanreotid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of FOXO4-DRI and Lanreotid in Germany and the United States?
- Германия: FOXO4-DRI — Только для исследований, Lanreotid — Рецептурный. США: FOXO4-DRI — Только для исследований, Lanreotid — Рецептурный. These are factual summaries with source and review date on the individual pages.