Сравнение
FOXO4-DRI vs. Leuprorelin
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
2074706-72-8
53714-56-0
Молекулярная масса
3735 g/mol
1209.4 g/mol
Период полувыведения
0.5 h
3 h
Последовательность
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Pyr-His-Trp-Ser-Tyr-D-Leu-Leu-Arg-Pro-NHEtМеханизм действия
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Leuprorelin
Leuprorelin is a GnRH-receptor agonist. After binding to pituitary GnRH receptors, it first causes a transient surge in luteinizing hormone (LH) and follicle-stimulating hormone (FSH) release — the so-called flare. With continuous, non-pulsatile exposure the receptors are downregulated and desensitized, suppressing gonadotropin secretion and consequently lowering sex steroids (testosterone or estradiol) to low levels. This mechanism underlies the literature-described use in hormone-dependent conditions.
Доказательная база
Наивысшая доказательность
Модель на животных
РКИ на людях
Исследования
3
4
из них на людях
0
4
Зафиксированные эффекты
3
4
Открытые противоречия
1
1
Задокументированные нежелательные явления
1
3
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between FOXO4-DRI and Leuprorelin?
- FOXO4-DRI is classified as "Исследования (прочее)", while Leuprorelin is classified as "Исследования (прочее)". FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. Leuprorelin: Leuprorelin (also leuprolide) is a synthetic nonapeptide analogue of gonadotropin-releasing hormone (GnRH/LHRH). It is an approved prescription medicine in several jurisdictions, including for advanced prostate cancer, endometriosis, uterine fibroids and central precocious puberty. This page neutrally summarizes the evidence base and legal status and is not a usage or dosing recommendation. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, FOXO4-DRI or Leuprorelin?
- The highest available evidence level is "Модель на животных" for FOXO4-DRI and "РКИ на людях" for Leuprorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of FOXO4-DRI and Leuprorelin in Germany and the United States?
- Германия: FOXO4-DRI — Только для исследований, Leuprorelin — Рецептурный. США: FOXO4-DRI — Только для исследований, Leuprorelin — Рецептурный. These are factual summaries with source and review date on the individual pages.