Сравнение
FOXO4-DRI vs. Octreotide
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
2074706-72-8
83150-76-9
Молекулярная масса
3735 g/mol
1019.24 g/mol
Период полувыведения
0.5 h
1.7 h
Последовательность
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)D-Phe-Cys-Phe-D-Trp-Lys-Thr-Cys-Thr(ol)Механизм действия
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Octreotide
Octreotide is a cyclic octapeptide that selectively binds somatostatin-receptor subtypes SSTR2 and SSTR5. Via G-protein-coupled signalling, adenylyl cyclase is inhibited, reducing the secretion of multiple hormones (growth hormone, IGF-1, glucagon, insulin, VIP, serotonin). Structural stabilisation via a disulfide bridge and D-amino acids extends the half-life relative to natural somatostatin (minutes to several hours).
Доказательная база
Наивысшая доказательность
Модель на животных
РКИ на людях
Исследования
3
5
из них на людях
0
4
Зафиксированные эффекты
3
3
Открытые противоречия
1
1
Задокументированные нежелательные явления
1
2
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between FOXO4-DRI and Octreotide?
- FOXO4-DRI is classified as "Исследования (прочее)", while Octreotide is classified as "Исследования (прочее)". FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. Octreotide: Synthetic octapeptide somatostatin analog with a longer half-life than endogenous somatostatin. FDA- and EMA-approved since the 1980s for acromegaly and neuroendocrine tumours. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, FOXO4-DRI or Octreotide?
- The highest available evidence level is "Модель на животных" for FOXO4-DRI and "РКИ на людях" for Octreotide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of FOXO4-DRI and Octreotide in Germany and the United States?
- Германия: FOXO4-DRI — Только для исследований, Octreotide — Рецептурный. США: FOXO4-DRI — Только для исследований, Octreotide — Рецептурный. These are factual summaries with source and review date on the individual pages.