Сравнение
FOXO4-DRI vs. Selank
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
2074706-72-8
129954-34-3
Молекулярная масса
3735 g/mol
751.85 g/mol
Период полувыведения
0.5 h
0.3 h
Последовательность
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Thr-Lys-Pro-Arg-Pro-Gly-ProМеханизм действия
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Selank
Selank is a glyproline-tuftsin analog. Proposed mechanisms include modulation of the GABAergic system, effects on serotonin bioavailability, and influence on enkephalinases. Animal studies show anxiolytic and neuroprotective markers; a clear receptor target is not established.
Доказательная база
Наивысшая доказательность
Модель на животных
Исследование на людях
Исследования
3
4
из них на людях
0
2
Зафиксированные эффекты
3
3
Открытые противоречия
1
1
Задокументированные нежелательные явления
1
1
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between FOXO4-DRI and Selank?
- FOXO4-DRI is classified as "Исследования (прочее)", while Selank is classified as "Исследования (прочее)". FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. Selank: Synthetic heptapeptide derived from natural tuftsin. Approved as an anxiolytic (Selank) in Russia and some CIS states. Western phase-3 trials are absent; efficacy assessment relies on Russian research literature. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, FOXO4-DRI or Selank?
- The highest available evidence level is "Модель на животных" for FOXO4-DRI and "Исследование на людях" for Selank. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of FOXO4-DRI and Selank in Germany and the United States?
- Германия: FOXO4-DRI — Только для исследований, Selank — Не одобрено. США: FOXO4-DRI — Только для исследований, Selank — Не одобрено. These are factual summaries with source and review date on the individual pages.