Сравнение
FOXO4-DRI vs. Terlipressin
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
2074706-72-8
14636-12-5
Молекулярная масса
3735 g/mol
1227.37 g/mol
Период полувыведения
0.5 h
нет данных
Последовательность
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)нет данных
Механизм действия
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Terlipressin
Terlipressin is slowly converted in the body to lysine-vasopressin by cleavage of the three N-terminal glycyl residues (reservoir effect) and activates V1 receptors. The splanchnic vasoconstriction improves renal perfusion in hepatorenal syndrome.
Доказательная база
Наивысшая доказательность
Модель на животных
РКИ на людях
Исследования
3
1
из них на людях
0
1
Зафиксированные эффекты
3
2
Открытые противоречия
1
0
Задокументированные нежелательные явления
1
1
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between FOXO4-DRI and Terlipressin?
- FOXO4-DRI is classified as "Исследования (прочее)", while Terlipressin is classified as "Исследования (прочее)". FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. Terlipressin: Terlipressin is a 12-amino-acid vasopressin analog and prodrug of lysine-vasopressin. As a V1 receptor agonist it is vasoconstrictive and is approved for hepatorenal syndrome (FDA 2022, Terlivaz). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, FOXO4-DRI or Terlipressin?
- The highest available evidence level is "Модель на животных" for FOXO4-DRI and "РКИ на людях" for Terlipressin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of FOXO4-DRI and Terlipressin in Germany and the United States?
- Германия: FOXO4-DRI — Только для исследований, Terlipressin — Рецептурный. США: FOXO4-DRI — Только для исследований, Terlipressin — Рецептурный. These are factual summaries with source and review date on the individual pages.