Сравнение
Goserelin vs. LL-37
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
65807-02-5
597562-32-8
Молекулярная масса
1269.43 g/mol
4493.33 g/mol
Период полувыведения
4.2 h
нет данных
Последовательность
pGlu-His-Trp-Ser-Tyr-D-Ser(tBu)-Leu-Arg-Pro-Azgly-NH2[LL-37, 37 aa]Механизм действия
Goserelin
As a GnRH agonist, goserelin binds to the GnRH receptors of the pituitary gland. Initial stimulation transiently raises luteinizing hormone (LH) and follicle-stimulating hormone (FSH). With continuous receptor occupancy, however, the receptors become desensitized and down-regulated, which reduces LH and FSH secretion and consequently the production of testosterone or estrogen. This mechanistic relationship is documented in the pharmacological literature.
LL-37
LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.
Доказательная база
Наивысшая доказательность
РКИ на людях
Исследование на людях
Исследования
4
4
из них на людях
4
1
Зафиксированные эффекты
3
4
Открытые противоречия
1
1
Задокументированные нежелательные явления
2
0
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Goserelin and LL-37?
- Goserelin is classified as "Исследования (прочее)", while LL-37 is classified as "Исследования (прочее)". Goserelin: Goserelin is a synthetic decapeptide and an agonist of gonadotropin-releasing hormone (GnRH). The medical literature describes it as a hormonal agent that suppresses the release of sex hormones through sustained receptor stimulation. Regulatory-approved indications include prostate cancer, advanced breast cancer, endometriosis, and endometrial thinning, among others. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Goserelin or LL-37?
- The highest available evidence level is "РКИ на людях" for Goserelin and "Исследование на людях" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Goserelin and LL-37 in Germany and the United States?
- Германия: Goserelin — Рецептурный, LL-37 — Только для исследований. США: Goserelin — Рецептурный, LL-37 — Только для исследований. These are factual summaries with source and review date on the individual pages.