Сравнение

Liraglutide vs. Maridebart Cafraglutide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

204656-20-2

нет данных

Молекулярная масса

3751 g/mol

нет данных

Период полувыведения

13 h

нет данных

Последовательность

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

нет данных

Механизм действия

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Maridebart Cafraglutide

MariTide combines GLP-1 receptor agonism with GIP receptor antagonism in an antibody-peptide conjugate. Its long duration of action allows infrequent (monthly) dosing.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Liraglutide	Maridebart Cafraglutide
Германия	Рецептурный	Не одобрено
США	Рецептурный	Не одобрено

Полные записи

Liraglutide

Полная запись →

Maridebart Cafraglutide

Полная запись →

Frequently asked questions

What is the difference between Liraglutide and Maridebart Cafraglutide?: Liraglutide is classified as "Метаболизм", while Maridebart Cafraglutide is classified as "Метаболизм". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Maridebart Cafraglutide?: The highest available evidence level is "РКИ на людях" for Liraglutide and "РКИ на людях" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Maridebart Cafraglutide in Germany and the United States?: Германия: Liraglutide — Рецептурный, Maridebart Cafraglutide — Не одобрено. США: Liraglutide — Рецептурный, Maridebart Cafraglutide — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Maridebart Cafraglutide

Германия

Рецептурный

Не одобрено

США

Рецептурный

Не одобрено

Frequently asked questions

What is the difference between Liraglutide and Maridebart Cafraglutide?

Liraglutide is classified as "Метаболизм", while Maridebart Cafraglutide is classified as "Метаболизм". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Maridebart Cafraglutide?

The highest available evidence level is "РКИ на людях" for Liraglutide and "РКИ на людях" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Maridebart Cafraglutide in Germany and the United States?

Германия: Liraglutide — Рецептурный, Maridebart Cafraglutide — Не одобрено. США: Liraglutide — Рецептурный, Maridebart Cafraglutide — Не одобрено. These are factual summaries with source and review date on the individual pages.