Сравнение
LL-37 vs. Nafarelin
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
597562-32-8
нет данных
Молекулярная масса
4493.33 g/mol
нет данных
Период полувыведения
нет данных
нет данных
Последовательность
[LL-37, 37 aa]нет данных
Механизм действия
LL-37
LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.
Nafarelin
Nafarelin is a potent GnRH agonist: after an initial stimulation ('flare'), continuous receptor occupancy leads to downregulation and thereby suppression of LH, FSH and the downstream sex hormones.
Доказательная база
Наивысшая доказательность
Исследование на людях
РКИ на людях
Исследования
4
0
из них на людях
1
0
Зафиксированные эффекты
4
2
Открытые противоречия
1
0
Задокументированные нежелательные явления
0
1
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between LL-37 and Nafarelin?
- LL-37 is classified as "Исследования (прочее)", while Nafarelin is classified as "Исследования (прочее)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Nafarelin: Nafarelin is a GnRH agonist and the only member of this class delivered as a nasal spray. It is approved for treating endometriosis and central precocious puberty. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, LL-37 or Nafarelin?
- The highest available evidence level is "Исследование на людях" for LL-37 and "РКИ на людях" for Nafarelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of LL-37 and Nafarelin in Germany and the United States?
- Германия: LL-37 — Только для исследований, Nafarelin — Рецептурный. США: LL-37 — Только для исследований, Nafarelin — Рецептурный. These are factual summaries with source and review date on the individual pages.