Confronto

CagriSema vs. Liraglutide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

nessun dato

204656-20-2

Peso molecolare

nessun dato

3751 g/mol

Emivita

nessun dato

13 h

Sequenza

nessun dato

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

Meccanismo d'azione

CagriSema

CagriSema combines two satiety pathways in one weekly injection: the amylin analogue cagrilintide and the GLP-1 agonist semaglutide. Both suppress appetite and food intake — together more than either component alone.

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	CagriSema	Liraglutide
Germania	Non approvato	Su prescrizione
Stati Uniti	Non approvato	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between CagriSema and Liraglutide?: CagriSema is classified as "Metabolico", while Liraglutide is classified as "Metabolico". CagriSema: CagriSema is a fixed-dose combination of the amylin analogue cagrilintide and the GLP-1 agonist semaglutide (Novo Nordisk), in late-stage development for obesity and type 2 diabetes. Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CagriSema or Liraglutide?: The highest available evidence level is "RCT sull'uomo" for CagriSema and "RCT sull'uomo" for Liraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CagriSema and Liraglutide in Germany and the United States?: Germania: CagriSema — Non approvato, Liraglutide — Su prescrizione. Stati Uniti: CagriSema — Non approvato, Liraglutide — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

CagriSema

Liraglutide

Germania

Non approvato

Su prescrizione

Stati Uniti

Non approvato

Su prescrizione

Frequently asked questions

What is the difference between CagriSema and Liraglutide?

CagriSema is classified as "Metabolico", while Liraglutide is classified as "Metabolico". CagriSema: CagriSema is a fixed-dose combination of the amylin analogue cagrilintide and the GLP-1 agonist semaglutide (Novo Nordisk), in late-stage development for obesity and type 2 diabetes. Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CagriSema or Liraglutide?

The highest available evidence level is "RCT sull'uomo" for CagriSema and "RCT sull'uomo" for Liraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CagriSema and Liraglutide in Germany and the United States?

Germania: CagriSema — Non approvato, Liraglutide — Su prescrizione. Stati Uniti: CagriSema — Non approvato, Liraglutide — Su prescrizione. These are factual summaries with source and review date on the individual pages.