Confronto
Degarelix vs. FOXO4-DRI
Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.
Identità
Categoria
Ricerca (altro)
Ricerca (altro)
N. CAS
214766-78-6
2074706-72-8
Peso molecolare
1632.3 g/mol
3735 g/mol
Emivita
1320 h
0.5 h
Sequenza
Ac-D-2Nal-D-4Cpa-D-3Pal-Ser-4Aph(Hor)-D-4Aph(Cbm)-Leu-Ilys-Pro-D-Ala-NH2D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Meccanismo d'azione
Degarelix
Degarelix is a competitive GnRH receptor antagonist. It binds reversibly and immediately to the pituitary GnRH receptors and blocks their activation. This rapidly suppresses the release of luteinizing hormone (LH) and follicle-stimulating hormone (FSH), which in turn lowers testosterone production in the testes. Unlike GnRH agonists (e.g., leuprorelin), which first cause a transient stimulation with a testosterone surge (flare), this direct antagonism lacks the initial stimulation phase, so testosterone declines without a preceding rise. This mechanism underlies the literature-described use in hormone-dependent prostate cancer.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Base di evidenze
Evidenza più alta
RCT sull'uomo
Modello animale
Studi
4
3
di cui sull'uomo
4
0
Effetti registrati
4
3
Contraddizioni aperte
1
1
Eventi avversi documentati
2
1
Stato legale
Voci complete
Frequently asked questions
- What is the difference between Degarelix and FOXO4-DRI?
- Degarelix is classified as "Ricerca (altro)", while FOXO4-DRI is classified as "Ricerca (altro)". Degarelix: Degarelix (trade name Firmagon) is a synthetic decapeptide and a gonadotropin-releasing hormone (GnRH) receptor antagonist. Unlike GnRH agonists, it blocks the receptor directly and does not trigger an initial testosterone surge (flare). It is an approved prescription medicine for the treatment of advanced, hormone-dependent prostate cancer. This page neutrally summarizes the evidence base and legal status and is not a usage or dosing recommendation. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Degarelix or FOXO4-DRI?
- The highest available evidence level is "RCT sull'uomo" for Degarelix and "Modello animale" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Degarelix and FOXO4-DRI in Germany and the United States?
- Germania: Degarelix — Su prescrizione, FOXO4-DRI — Solo ricerca. Stati Uniti: Degarelix — Su prescrizione, FOXO4-DRI — Solo ricerca. These are factual summaries with source and review date on the individual pages.