Confronto
FOXO4-DRI vs. Oxytocin
Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.
Identità
Categoria
Ricerca (altro)
Ricerca (altro)
N. CAS
2074706-72-8
50-56-6
Peso molecolare
3735 g/mol
1007.19 g/mol
Emivita
0.5 h
0.05 h
Sequenza
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2Meccanismo d'azione
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Oxytocin
Oxytocin is synthesised in the hypothalamus and released via the posterior pituitary. Peripherally it binds the oxytocin receptor, a G-protein-coupled receptor, and through the phospholipase-C cascade and calcium release triggers contraction of uterine smooth muscle and milk ejection — the pharmacological basis of the obstetric approval. Centrally, oxytocin acts as a neuromodulator and has been linked to social bonding, trust and modulation of stress and anxiety circuits. Its central effects in humans are mechanistically incompletely understood, particularly because it is unclear to what extent peripherally or intranasally administered oxytocin crosses the blood-brain barrier.
Base di evidenze
Evidenza più alta
Modello animale
RCT sull'uomo
Studi
3
4
di cui sull'uomo
0
4
Effetti registrati
3
3
Contraddizioni aperte
1
1
Eventi avversi documentati
1
0
Stato legale
Voci complete
Frequently asked questions
- What is the difference between FOXO4-DRI and Oxytocin?
- FOXO4-DRI is classified as "Ricerca (altro)", while Oxytocin is classified as "Ricerca (altro)". FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. Oxytocin: Oxytocin is an endogenous nonapeptide hormone of the posterior pituitary. In synthetic form (Pitocin, Syntocinon) it has been approved for decades to induce and augment labour and to control postpartum uterine bleeding. Strictly separate from this is intranasal use to influence social behaviour, trust, anxiety or autism symptoms: this use is unapproved, purely experimental, and yields inconsistent and often negative results in controlled trials. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, FOXO4-DRI or Oxytocin?
- The highest available evidence level is "Modello animale" for FOXO4-DRI and "RCT sull'uomo" for Oxytocin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of FOXO4-DRI and Oxytocin in Germany and the United States?
- Germania: FOXO4-DRI — Solo ricerca, Oxytocin — Su prescrizione. Stati Uniti: FOXO4-DRI — Solo ricerca, Oxytocin — Su prescrizione. These are factual summaries with source and review date on the individual pages.