Confronto

Lixisenatide vs. Petrelintide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

320367-13-3

nessun dato

Peso molecolare

4858.5 g/mol

nessun dato

Emivita

3 h

nessun dato

Sequenza

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

nessun dato

Meccanismo d'azione

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Petrelintide

As an amylin analogue, petrelintide acts through amylin receptors, promoting satiety and slowed gastric emptying — a satiety pathway independent of the GLP-1 axis.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Lixisenatide	Petrelintide
Germania	Su prescrizione	Non approvato
JP	Su prescrizione	—
Stati Uniti	Non approvato	Non approvato

Voci complete

Frequently asked questions

What is the difference between Lixisenatide and Petrelintide?: Lixisenatide is classified as "Metabolico", while Petrelintide is classified as "Metabolico". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Lixisenatide or Petrelintide?: The highest available evidence level is "RCT sull'uomo" for Lixisenatide and "RCT sull'uomo" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Lixisenatide and Petrelintide in Germany and the United States?: Germania: Lixisenatide — Su prescrizione, Petrelintide — Non approvato. Stati Uniti: Lixisenatide — Non approvato, Petrelintide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Lixisenatide

Petrelintide

Germania

Su prescrizione

Non approvato

Su prescrizione

—

Stati Uniti

Non approvato

Frequently asked questions

What is the difference between Lixisenatide and Petrelintide?

Lixisenatide is classified as "Metabolico", while Petrelintide is classified as "Metabolico". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Lixisenatide or Petrelintide?

The highest available evidence level is "RCT sull'uomo" for Lixisenatide and "RCT sull'uomo" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Lixisenatide and Petrelintide in Germany and the United States?

Germania: Lixisenatide — Su prescrizione, Petrelintide — Non approvato. Stati Uniti: Lixisenatide — Non approvato, Petrelintide — Non approvato. These are factual summaries with source and review date on the individual pages.