Сравнение
Abaloparatid vs. LL-37
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
247062-33-5
597562-32-8
Молекулярная масса
3960.6 g/mol
4493.33 g/mol
Период полувыведения
1.7 h
нет данных
Последовательность
Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Glu-Leu-Leu-Glu-Lys-Leu-Leu-Aib-Lys-Leu-His-Thr-Ala-NH2[LL-37, 37 aa]Механизм действия
Abaloparatid
Abaloparatide is a synthetic analogue of the first 34 amino acids of parathyroid hormone-related protein (PTHrP). Like parathyroid hormone and teriparatide it binds the PTH-1 receptor, but the literature describes it as preferentially engaging the so-called RG conformation of the receptor, which is associated with shorter signaling duration. As for the entire drug class, intermittent receptor activation is regarded as the mechanistic basis for the stimulation of bone-forming osteoblasts observed in studies, whereas continuously elevated exposure would tend to favor bone resorption. From this binding behavior the literature derives a discussed balance between bone formation and bone resorption.
LL-37
LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.
Доказательная база
Наивысшая доказательность
РКИ на людях
Исследование на людях
Исследования
4
4
из них на людях
4
1
Зафиксированные эффекты
4
4
Открытые противоречия
1
1
Задокументированные нежелательные явления
2
0
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Abaloparatid and LL-37?
- Abaloparatid is classified as "Исследования (прочее)", while LL-37 is classified as "Исследования (прочее)". Abaloparatid: Abaloparatide is a synthetic 34-amino-acid analogue of parathyroid hormone-related protein (PTHrP 1-34). It is regulatory-approved and studied in the scientific literature as a bone-anabolic agent for the treatment of osteoporosis in postmenopausal women at high fracture risk. Like the related teriparatide, studies describe it as stimulating new bone formation, but it exhibits a distinct receptor-binding profile. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Abaloparatid or LL-37?
- The highest available evidence level is "РКИ на людях" for Abaloparatid and "Исследование на людях" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Abaloparatid and LL-37 in Germany and the United States?
- Германия: Abaloparatid — Рецептурный, LL-37 — Только для исследований. США: Abaloparatid — Рецептурный, LL-37 — Только для исследований. These are factual summaries with source and review date on the individual pages.