Сравнение

Cagrilintide vs. Petrelintide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

1415456-99-3

нет данных

Молекулярная масса

4253.7 g/mol

нет данных

Период полувыведения

168 h

нет данных

Последовательность

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

нет данных

Механизм действия

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Petrelintide

As an amylin analogue, petrelintide acts through amylin receptors, promoting satiety and slowed gastric emptying — a satiety pathway independent of the GLP-1 axis.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Cagrilintide	Petrelintide
Германия	Не одобрено	Не одобрено
DK	Не одобрено	—
США	Не одобрено	Не одобрено

Полные записи

Frequently asked questions

What is the difference between Cagrilintide and Petrelintide?: Cagrilintide is classified as "Метаболизм", while Petrelintide is classified as "Метаболизм". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Petrelintide?: The highest available evidence level is "РКИ на людях" for Cagrilintide and "РКИ на людях" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Petrelintide in Germany and the United States?: Германия: Cagrilintide — Не одобрено, Petrelintide — Не одобрено. США: Cagrilintide — Не одобрено, Petrelintide — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Petrelintide

Германия

Не одобрено

—

США

Не одобрено

Frequently asked questions

What is the difference between Cagrilintide and Petrelintide?

Cagrilintide is classified as "Метаболизм", while Petrelintide is classified as "Метаболизм". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Petrelintide?

The highest available evidence level is "РКИ на людях" for Cagrilintide and "РКИ на людях" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Petrelintide in Germany and the United States?

Германия: Cagrilintide — Не одобрено, Petrelintide — Не одобрено. США: Cagrilintide — Не одобрено, Petrelintide — Не одобрено. These are factual summaries with source and review date on the individual pages.