Сравнение
Cerebrolysin vs. FOXO4-DRI
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
96889-70-6
2074706-72-8
Молекулярная масса
нет данных
3735 g/mol
Период полувыведения
нет данных
0.5 h
Последовательность
нет данных
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Механизм действия
Cerebrolysin
Cerebrolysin is a mixture of low-molecular-weight peptides (predominantly below 10 kDa) and free amino acids obtained by enzymatic cleavage of lipid-free porcine brain proteins. The manufacturer and preclinical literature describe a neurotrophic and neuroprotective mode of action said to mimic endogenous neurotrophic factors; cell and animal models have reported effects on neuronal survival, synaptogenesis and anti-apoptotic signalling (including PI3K/Akt). Because it is a complex, incompletely characterised mixture, the precise mechanism in humans remains unclear.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Доказательная база
Наивысшая доказательность
РКИ на людях
Модель на животных
Исследования
4
3
из них на людях
4
0
Зафиксированные эффекты
4
3
Открытые противоречия
1
1
Задокументированные нежелательные явления
1
1
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Cerebrolysin and FOXO4-DRI?
- Cerebrolysin is classified as "Исследования (прочее)", while FOXO4-DRI is classified as "Исследования (прочее)". Cerebrolysin: Cerebrolysin (FPF-1070) is not a single peptide but a porcine-brain-derived preparation of low-molecular-weight peptides and free amino acids, produced by standardised enzymatic proteolysis. It is approved in several countries (including Austria, Russia and parts of Asia) for stroke, dementia and traumatic brain injury, but is not FDA-approved in the United States and not centrally approved by the EMA. Its efficacy is contested: Cochrane systematic reviews found no convincing benefit and flagged possible harm signals. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Cerebrolysin or FOXO4-DRI?
- The highest available evidence level is "РКИ на людях" for Cerebrolysin and "Модель на животных" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Cerebrolysin and FOXO4-DRI in Germany and the United States?
- Германия: Cerebrolysin — Неясно, FOXO4-DRI — Только для исследований. США: Cerebrolysin — Не одобрено, FOXO4-DRI — Только для исследований. These are factual summaries with source and review date on the individual pages.