Comparison
Cerebrolysin vs. FOXO4-DRI
Two peptides side-by-side — identity, evidence base, legal status and known adverse events.
Identity
Category
Research other
Research other
CAS no.
96889-70-6
2074706-72-8
Molecular weight
no data
3735 g/mol
Half-life
no data
0.5 h
Sequence
no data
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Mechanism of action
Cerebrolysin
Cerebrolysin is a mixture of low-molecular-weight peptides (predominantly below 10 kDa) and free amino acids obtained by enzymatic cleavage of lipid-free porcine brain proteins. The manufacturer and preclinical literature describe a neurotrophic and neuroprotective mode of action said to mimic endogenous neurotrophic factors; cell and animal models have reported effects on neuronal survival, synaptogenesis and anti-apoptotic signalling (including PI3K/Akt). Because it is a complex, incompletely characterised mixture, the precise mechanism in humans remains unclear.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Evidence base
Highest evidence
Human RCT
Animal model
Studies
4
3
of which in humans
4
0
Effects recorded
4
3
Open conflicts
1
1
Documented adverse events
1
1
Legal status
Full entries
Frequently asked questions
- What is the difference between Cerebrolysin and FOXO4-DRI?
- Cerebrolysin is classified as "Research other", while FOXO4-DRI is classified as "Research other". Cerebrolysin: Cerebrolysin (FPF-1070) is not a single peptide but a porcine-brain-derived preparation of low-molecular-weight peptides and free amino acids, produced by standardised enzymatic proteolysis. It is approved in several countries (including Austria, Russia and parts of Asia) for stroke, dementia and traumatic brain injury, but is not FDA-approved in the United States and not centrally approved by the EMA. Its efficacy is contested: Cochrane systematic reviews found no convincing benefit and flagged possible harm signals. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Cerebrolysin or FOXO4-DRI?
- The highest available evidence level is "Human RCT" for Cerebrolysin and "Animal model" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Cerebrolysin and FOXO4-DRI in Germany and the United States?
- Germany: Cerebrolysin — Unclear, FOXO4-DRI — Research only. United States: Cerebrolysin — Unapproved, FOXO4-DRI — Research only. These are factual summaries with source and review date on the individual pages.