Сравнение

CJC-1295 vs. Ipamorelin

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Рост

Номер CAS

нет данных

170851-70-4

Молекулярная масса

3647.3 g/mol

711.86 g/mol

Период полувыведения

144 h

2 h

Последовательность

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

Aib-His-D-2-Nal-D-Phe-Lys-NH2

Механизм действия

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Ipamorelin

Ipamorelin is a selective agonist at the GH secretagogue receptor (GHSR-1a). Compared to GHRP-2 and GHRP-6 its selectivity for the growth-hormone axis is higher; ACTH, cortisol and prolactin are not significantly stimulated in clinical studies. This selectivity was the main reason for its development over older GHRPs.

Доказательная база

Наивысшая доказательность

Исследование на людях

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	CJC-1295	Ipamorelin
Германия	Не одобрено	Не одобрено
США	Только для исследований	Не одобрено

Полные записи

Frequently asked questions

What is the difference between CJC-1295 and Ipamorelin?: CJC-1295 is classified as "Рост", while Ipamorelin is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Ipamorelin: Synthetic pentapeptide and selective growth-hormone secretagogue. Developed at Novo Nordisk in the 1990s as a pentapeptide GHRP successor; clinical development was discontinued after phase 2 (post-operative ileus). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Ipamorelin?: The highest available evidence level is "Исследование на людях" for CJC-1295 and "РКИ на людях" for Ipamorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Ipamorelin in Germany and the United States?: Германия: CJC-1295 — Не одобрено, Ipamorelin — Не одобрено. США: CJC-1295 — Только для исследований, Ipamorelin — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Ipamorelin

Германия

Не одобрено

США

Только для исследований

Не одобрено

Frequently asked questions

What is the difference between CJC-1295 and Ipamorelin?

CJC-1295 is classified as "Рост", while Ipamorelin is classified as "Рост". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Ipamorelin: Synthetic pentapeptide and selective growth-hormone secretagogue. Developed at Novo Nordisk in the 1990s as a pentapeptide GHRP successor; clinical development was discontinued after phase 2 (post-operative ileus). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Ipamorelin?

The highest available evidence level is "Исследование на людях" for CJC-1295 and "РКИ на людях" for Ipamorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Ipamorelin in Germany and the United States?

Германия: CJC-1295 — Не одобрено, Ipamorelin — Не одобрено. США: CJC-1295 — Только для исследований, Ipamorelin — Не одобрено. These are factual summaries with source and review date on the individual pages.