Confronto

CJC-1295 vs. Ipamorelin

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Crescita

N. CAS

nessun dato

170851-70-4

Peso molecolare

3647.3 g/mol

711.86 g/mol

Emivita

144 h

2 h

Sequenza

YADAIFTNSYRKVLGQLSARKLLQDIMSR-DAC

Aib-His-D-2-Nal-D-Phe-Lys-NH2

Meccanismo d'azione

CJC-1295

Synthetic analogue of growth-hormone-releasing hormone (GHRH), modified for extended half-life via a Drug Affinity Complex (DAC) binding to albumin. Acts on the pituitary GHRH receptor and stimulates endogenous growth-hormone release.

Ipamorelin

Ipamorelin is a selective agonist at the GH secretagogue receptor (GHSR-1a). Compared to GHRP-2 and GHRP-6 its selectivity for the growth-hormone axis is higher; ACTH, cortisol and prolactin are not significantly stimulated in clinical studies. This selectivity was the main reason for its development over older GHRPs.

Base di evidenze

Evidenza più alta

Studio sull'uomo

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	CJC-1295	Ipamorelin
Germania	Non approvato	Non approvato
Stati Uniti	Solo ricerca	Non approvato

Voci complete

Frequently asked questions

What is the difference between CJC-1295 and Ipamorelin?: CJC-1295 is classified as "Crescita", while Ipamorelin is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Ipamorelin: Synthetic pentapeptide and selective growth-hormone secretagogue. Developed at Novo Nordisk in the 1990s as a pentapeptide GHRP successor; clinical development was discontinued after phase 2 (post-operative ileus). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CJC-1295 or Ipamorelin?: The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "RCT sull'uomo" for Ipamorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CJC-1295 and Ipamorelin in Germany and the United States?: Germania: CJC-1295 — Non approvato, Ipamorelin — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, Ipamorelin — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

CJC-1295

Ipamorelin

Germania

Non approvato

Stati Uniti

Solo ricerca

Non approvato

Frequently asked questions

What is the difference between CJC-1295 and Ipamorelin?

CJC-1295 is classified as "Crescita", while Ipamorelin is classified as "Crescita". CJC-1295: Long-acting synthetic GHRH analogue modified for albumin binding (DAC). Stimulates endogenous growth-hormone release. Pharmacodynamic effect established in small human studies; clinical endpoint trials are missing. Ipamorelin: Synthetic pentapeptide and selective growth-hormone secretagogue. Developed at Novo Nordisk in the 1990s as a pentapeptide GHRP successor; clinical development was discontinued after phase 2 (post-operative ileus). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CJC-1295 or Ipamorelin?

The highest available evidence level is "Studio sull'uomo" for CJC-1295 and "RCT sull'uomo" for Ipamorelin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CJC-1295 and Ipamorelin in Germany and the United States?

Germania: CJC-1295 — Non approvato, Ipamorelin — Non approvato. Stati Uniti: CJC-1295 — Solo ricerca, Ipamorelin — Non approvato. These are factual summaries with source and review date on the individual pages.