Сравнение
Enfuvirtid vs. FOXO4-DRI
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
159519-65-0
2074706-72-8
Молекулярная масса
4491.88 g/mol
3735 g/mol
Период полувыведения
нет данных
0.5 h
Последовательность
нет данных
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Механизм действия
Enfuvirtid
Enfuvirtide binds the first heptad-repeat region (HR1) of the gp41 subunit of the HIV envelope protein. This prevents the conformational change required for fusion of the viral and cell membranes — the virus cannot enter the cell.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Доказательная база
Наивысшая доказательность
РКИ на людях
Модель на животных
Исследования
1
3
из них на людях
1
0
Зафиксированные эффекты
2
3
Открытые противоречия
0
1
Задокументированные нежелательные явления
1
1
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Enfuvirtid and FOXO4-DRI?
- Enfuvirtid is classified as "Исследования (прочее)", while FOXO4-DRI is classified as "Исследования (прочее)". Enfuvirtid: Enfuvirtide is a synthetic 36-amino-acid peptide and the first HIV-1 fusion inhibitor. It binds the HR1 region of the viral envelope protein gp41, blocking viral entry into the cell. Approved for treatment-experienced HIV patients. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Enfuvirtid or FOXO4-DRI?
- The highest available evidence level is "РКИ на людях" for Enfuvirtid and "Модель на животных" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Enfuvirtid and FOXO4-DRI in Germany and the United States?
- Германия: Enfuvirtid — Рецептурный, FOXO4-DRI — Только для исследований. США: Enfuvirtid — Рецептурный, FOXO4-DRI — Только для исследований. These are factual summaries with source and review date on the individual pages.