Сравнение

Exenatide vs. VK2735

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

141758-74-9

нет данных

Молекулярная масса

4186.6 g/mol

нет данных

Период полувыведения

2.4 h

нет данных

Последовательность

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

нет данных

Механизм действия

Exenatide

Exenatide is a 39-amino-acid peptide with about 53% sequence homology to human GLP-1. A glycine substitution at position 2 prevents dipeptidyl-peptidase-IV cleavage and extends the half-life from native GLP-1 (minutes) to about 2.4 hours. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon and delays gastric emptying.

VK2735

VK2735 activates both the GLP-1 and the GIP receptor — a dual mechanism similar to that of tirzepatide, suppressing appetite and food intake.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Exenatide	VK2735
Германия	Рецептурный	Не одобрено
США	Рецептурный	Не одобрено

Полные записи

Frequently asked questions

What is the difference between Exenatide and VK2735?: Exenatide is classified as "Метаболизм", while VK2735 is classified as "Метаболизм". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Exenatide or VK2735?: The highest available evidence level is "РКИ на людях" for Exenatide and "РКИ на людях" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Exenatide and VK2735 in Germany and the United States?: Германия: Exenatide — Рецептурный, VK2735 — Не одобрено. США: Exenatide — Рецептурный, VK2735 — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

Exenatide

VK2735

Германия

Рецептурный

Не одобрено

США

Рецептурный

Не одобрено

Frequently asked questions

What is the difference between Exenatide and VK2735?

Exenatide is classified as "Метаболизм", while VK2735 is classified as "Метаболизм". Exenatide: Synthetic version of exendin-4, originally isolated from the saliva of the Gila monster (Heloderma suspectum). First GLP-1 receptor agonist, FDA-approved 2005 as Byetta. Weekly depot form Bydureon approved 2012. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Exenatide or VK2735?

The highest available evidence level is "РКИ на людях" for Exenatide and "РКИ на людях" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Exenatide and VK2735 in Germany and the United States?

Германия: Exenatide — Рецептурный, VK2735 — Не одобрено. США: Exenatide — Рецептурный, VK2735 — Не одобрено. These are factual summaries with source and review date on the individual pages.