Сравнение
Gonadorelin vs. LL-37
Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.
Идентичность
Категория
Исследования (прочее)
Исследования (прочее)
Номер CAS
33515-09-2
597562-32-8
Молекулярная масса
1182.29 g/mol
4493.33 g/mol
Период полувыведения
0.1 h
нет данных
Последовательность
pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESМеханизм действия
Gonadorelin
Gonadorelin acts as an agonist at the GnRH receptor on the gonadotroph cells of the pituitary and triggers release of the gonadotropins luteinizing hormone (LH) and follicle-stimulating hormone (FSH). The temporal pattern of receptor exposure is decisive: pulsatile administration mimics the natural hypothalamic secretory rhythm and sustains LH/FSH release, whereas continuous exposure leads to receptor internalisation and desensitisation with subsequent paradoxical suppression of gonadotropins. The latter principle is exploited therapeutically by longer-acting GnRH agonists.
LL-37
LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.
Доказательная база
Наивысшая доказательность
Исследование на людях
Исследование на людях
Исследования
4
4
из них на людях
4
1
Зафиксированные эффекты
4
4
Открытые противоречия
1
1
Задокументированные нежелательные явления
2
0
Правовой статус
Полные записи
Frequently asked questions
- What is the difference between Gonadorelin and LL-37?
- Gonadorelin is classified as "Исследования (прочее)", while LL-37 is classified as "Исследования (прочее)". Gonadorelin: Gonadorelin is the synthetic decapeptide with an amino-acid sequence identical to endogenous gonadotropin-releasing hormone (GnRH/LHRH). Historically approved in several countries for diagnostic testing of pituitary function and for fertility indications (pump systems). A defining feature is the opposite effect of pulsatile versus continuous administration: pulsatile stimulates, continuous leads to receptor desensitisation. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Gonadorelin or LL-37?
- The highest available evidence level is "Исследование на людях" for Gonadorelin and "Исследование на людях" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Gonadorelin and LL-37 in Germany and the United States?
- Германия: Gonadorelin — Рецептурный, LL-37 — Только для исследований. США: Gonadorelin — Рецептурный, LL-37 — Только для исследований. These are factual summaries with source and review date on the individual pages.