Сравнение

Liraglutide vs. Petrelintide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

204656-20-2

нет данных

Молекулярная масса

3751 g/mol

нет данных

Период полувыведения

13 h

нет данных

Последовательность

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

нет данных

Механизм действия

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Petrelintide

As an amylin analogue, petrelintide acts through amylin receptors, promoting satiety and slowed gastric emptying — a satiety pathway independent of the GLP-1 axis.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Liraglutide	Petrelintide
Германия	Рецептурный	Не одобрено
США	Рецептурный	Не одобрено

Полные записи

Frequently asked questions

What is the difference between Liraglutide and Petrelintide?: Liraglutide is classified as "Метаболизм", while Petrelintide is classified as "Метаболизм". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Petrelintide?: The highest available evidence level is "РКИ на людях" for Liraglutide and "РКИ на людях" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Petrelintide in Germany and the United States?: Германия: Liraglutide — Рецептурный, Petrelintide — Не одобрено. США: Liraglutide — Рецептурный, Petrelintide — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Petrelintide

Германия

Рецептурный

Не одобрено

США

Рецептурный

Не одобрено

Frequently asked questions

What is the difference between Liraglutide and Petrelintide?

Liraglutide is classified as "Метаболизм", while Petrelintide is classified as "Метаболизм". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Petrelintide?

The highest available evidence level is "РКИ на людях" for Liraglutide and "РКИ на людях" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Petrelintide in Germany and the United States?

Германия: Liraglutide — Рецептурный, Petrelintide — Не одобрено. США: Liraglutide — Рецептурный, Petrelintide — Не одобрено. These are factual summaries with source and review date on the individual pages.