Confronto

Liraglutide vs. Petrelintide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

204656-20-2

nessun dato

Peso molecolare

3751 g/mol

nessun dato

Emivita

13 h

nessun dato

Sequenza

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

nessun dato

Meccanismo d'azione

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Petrelintide

As an amylin analogue, petrelintide acts through amylin receptors, promoting satiety and slowed gastric emptying — a satiety pathway independent of the GLP-1 axis.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Liraglutide	Petrelintide
Germania	Su prescrizione	Non approvato
Stati Uniti	Su prescrizione	Non approvato

Voci complete

Frequently asked questions

What is the difference between Liraglutide and Petrelintide?: Liraglutide is classified as "Metabolico", while Petrelintide is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Petrelintide?: The highest available evidence level is "RCT sull'uomo" for Liraglutide and "RCT sull'uomo" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Petrelintide in Germany and the United States?: Germania: Liraglutide — Su prescrizione, Petrelintide — Non approvato. Stati Uniti: Liraglutide — Su prescrizione, Petrelintide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Petrelintide

Germania

Su prescrizione

Non approvato

Stati Uniti

Su prescrizione

Non approvato

Frequently asked questions

What is the difference between Liraglutide and Petrelintide?

Liraglutide is classified as "Metabolico", while Petrelintide is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Petrelintide: Petrelintide is a long-acting amylin analogue (Zealand Pharma, with Roche) for once-weekly subcutaneous use — developed for weight management with a focus on strong tolerability. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Petrelintide?

The highest available evidence level is "RCT sull'uomo" for Liraglutide and "RCT sull'uomo" for Petrelintide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Petrelintide in Germany and the United States?

Germania: Liraglutide — Su prescrizione, Petrelintide — Non approvato. Stati Uniti: Liraglutide — Su prescrizione, Petrelintide — Non approvato. These are factual summaries with source and review date on the individual pages.