Сравнение

Lixisenatide vs. Maridebart Cafraglutide

Два пептида рядом — идентичность, доказательная база, правовой статус и известные нежелательные явления.

Идентичность

Категория

Метаболизм

Номер CAS

320367-13-3

нет данных

Молекулярная масса

4858.5 g/mol

нет данных

Период полувыведения

3 h

нет данных

Последовательность

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

нет данных

Механизм действия

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Maridebart Cafraglutide

MariTide combines GLP-1 receptor agonism with GIP receptor antagonism in an antibody-peptide conjugate. Its long duration of action allows infrequent (monthly) dosing.

Доказательная база

Наивысшая доказательность

РКИ на людях

Исследования

из них на людях

Зафиксированные эффекты

Открытые противоречия

Задокументированные нежелательные явления

Правовой статус

Country	Lixisenatide	Maridebart Cafraglutide
Германия	Рецептурный	Не одобрено
JP	Рецептурный	—
США	Не одобрено	Не одобрено

Полные записи

Lixisenatide

Полная запись →

Maridebart Cafraglutide

Полная запись →

Frequently asked questions

What is the difference between Lixisenatide and Maridebart Cafraglutide?: Lixisenatide is classified as "Метаболизм", while Maridebart Cafraglutide is classified as "Метаболизм". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Lixisenatide or Maridebart Cafraglutide?: The highest available evidence level is "РКИ на людях" for Lixisenatide and "РКИ на людях" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Lixisenatide and Maridebart Cafraglutide in Germany and the United States?: Германия: Lixisenatide — Рецептурный, Maridebart Cafraglutide — Не одобрено. США: Lixisenatide — Не одобрено, Maridebart Cafraglutide — Не одобрено. These are factual summaries with source and review date on the individual pages.

Country

Lixisenatide

Maridebart Cafraglutide

Германия

Рецептурный

Не одобрено

Рецептурный

—

США

Не одобрено

Frequently asked questions

What is the difference between Lixisenatide and Maridebart Cafraglutide?

Lixisenatide is classified as "Метаболизм", while Maridebart Cafraglutide is classified as "Метаболизм". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Lixisenatide or Maridebart Cafraglutide?

The highest available evidence level is "РКИ на людях" for Lixisenatide and "РКИ на людях" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Lixisenatide and Maridebart Cafraglutide in Germany and the United States?

Германия: Lixisenatide — Рецептурный, Maridebart Cafraglutide — Не одобрено. США: Lixisenatide — Не одобрено, Maridebart Cafraglutide — Не одобрено. These are factual summaries with source and review date on the individual pages.