Vergelijking

Lixisenatide vs. Maridebart Cafraglutide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

320367-13-3

geen gegevens

Molecuulmassa

4858.5 g/mol

geen gegevens

Halfwaardetijd

3 h

geen gegevens

Sequentie

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

geen gegevens

Werkingsmechanisme

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Maridebart Cafraglutide

MariTide combines GLP-1 receptor agonism with GIP receptor antagonism in an antibody-peptide conjugate. Its long duration of action allows infrequent (monthly) dosing.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Lixisenatide	Maridebart Cafraglutide
Duitsland	Op recept	Niet goedgekeurd
JP	Op recept	—
Verenigde Staten	Niet goedgekeurd	Niet goedgekeurd

Volledige vermeldingen

Lixisenatide

Volledige vermelding →

Maridebart Cafraglutide

Volledige vermelding →

Frequently asked questions

What is the difference between Lixisenatide and Maridebart Cafraglutide?: Lixisenatide is classified as "Metabool", while Maridebart Cafraglutide is classified as "Metabool". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Lixisenatide or Maridebart Cafraglutide?: The highest available evidence level is "Humane RCT" for Lixisenatide and "Humane RCT" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Lixisenatide and Maridebart Cafraglutide in Germany and the United States?: Duitsland: Lixisenatide — Op recept, Maridebart Cafraglutide — Niet goedgekeurd. Verenigde Staten: Lixisenatide — Niet goedgekeurd, Maridebart Cafraglutide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Lixisenatide

Maridebart Cafraglutide

Duitsland

Op recept

Niet goedgekeurd

Op recept

—

Verenigde Staten

Niet goedgekeurd

Frequently asked questions

What is the difference between Lixisenatide and Maridebart Cafraglutide?

Lixisenatide is classified as "Metabool", while Maridebart Cafraglutide is classified as "Metabool". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. Maridebart Cafraglutide: Maridebart cafraglutide (MariTide, Amgen) is a bispecific molecule: a GLP-1 receptor agonist combined with a GIP receptor antagonist, designed for monthly dosing; in phase 3 for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Lixisenatide or Maridebart Cafraglutide?

The highest available evidence level is "Humane RCT" for Lixisenatide and "Humane RCT" for Maridebart Cafraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Lixisenatide and Maridebart Cafraglutide in Germany and the United States?

Duitsland: Lixisenatide — Op recept, Maridebart Cafraglutide — Niet goedgekeurd. Verenigde Staten: Lixisenatide — Niet goedgekeurd, Maridebart Cafraglutide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.