Comparación
FOXO4-DRI vs. Humanin
Dos péptidos lado a lado — identidad, base de evidencia, estatus legal y efectos adversos conocidos.
Identidad
Categoría
Investigación (otros)
Investigación (otros)
N.º CAS
2074706-72-8
330936-69-1
Peso molecular
3735 g/mol
2687.27 g/mol
Semivida
0.5 h
sin datos
Secuencia
D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-AlaMecanismo de acción
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Humanin
Humanin arises from a short open reading frame within the 16S rRNA region of the mitochondrial genome (MT-RNR2) — it is therefore not encoded by nuclear DNA. Mechanistically, preclinical work describes a cytoprotective, anti-apoptotic effect via multiple pathways: an extracellular interaction with a trimeric receptor complex of gp130, CNTFR and WSX-1 with downstream activation of JAK2/STAT3 signalling, as well as intracellular interactions including inhibition of the pro-apoptotic protein BAX (and of tBID), binding to IGFBP-3 with modulation of the IGF-1 axis, and interaction with FPRL1/FPRL2 receptors. These models derive predominantly from cell culture and rodents; the extent to which they reflect human physiology after administration of exogenous synthetic humanin is not established by controlled human trials.
Base de evidencia
Evidencia más alta
Modelo animal
Estudio en humanos
Estudios
3
4
de ellos en humanos
0
1
Efectos registrados
3
4
Contradicciones abiertas
1
1
Efectos adversos documentados
1
0
Estatus legal
Entradas completas
Frequently asked questions
- ¿Cuál es la diferencia entre FOXO4-DRI y Humanin?
- FOXO4-DRI se clasifica como «Investigación (otros)», mientras que Humanin se clasifica como «Investigación (otros)». FOXO4-DRI: El FOXO4-DRI es un péptido senolítico (D-retro-inverso) en investigación preclínica para eliminar células senescentes; sin datos en humanos. Humanin: La humanina es un péptido mitocondrial estudiado por efectos citoprotectores y metabólicos; investigación temprana, sin aprobación. Esta página los contrasta de forma neutral y basada en fuentes — sin recomendación de uso ni de dosis.
- ¿Qué péptido está mejor respaldado por la ciencia, FOXO4-DRI o Humanin?
- El nivel de evidencia más alto disponible es «Modelo animal» para FOXO4-DRI y «Estudio en humanos» para Humanin. Un nivel de evidencia más alto significa datos más sólidos, pero no dice nada sobre la idoneidad para una persona concreta. La base de evidencia completa está en la página de cada péptido.
- ¿Cuál es el estatus legal de FOXO4-DRI y Humanin en Alemania y Estados Unidos?
- Alemania: FOXO4-DRI — Solo investigación, Humanin — No aprobado. Estados Unidos: FOXO4-DRI — Solo investigación, Humanin — Solo investigación. Son resúmenes factuales con fuente y fecha de revisión en las páginas individuales.