Confronto
Afamelanotide vs. FOXO4-DRI
Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.
Identità
Categoria
Ricerca (altro)
Ricerca (altro)
N. CAS
75921-69-6
2074706-72-8
Peso molecolare
1646.87 g/mol
3735 g/mol
Emivita
12 h
0.5 h
Sequenza
Ac-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2D-Retro-Inverso-Variante eines FOXO4-Peptid-Fragments (LTLRKEPASEIAQSILEAYSQNGWANRRSGGKR — D-Aminosäuren in umgekehrter Sequenz)Meccanismo d'azione
Afamelanotide
Afamelanotide is a synthetic analogue of α-melanocyte-stimulating hormone. It differs from native α-MSH by two substitutions — norleucine at position 4 and D-phenylalanine at position 7 — which make it metabolically more stable and more potent. As an agonist at the melanocortin-1 receptor (MC1R) on melanocytes, it activates adenylate cyclase, raises cAMP and increases tyrosinase activity via the transcription factor MITF. This shifts pigment synthesis toward eumelanin, which absorbs UV and visible light and has antioxidant properties — the presumed mechanism of photoprotection in EPP.
FOXO4-DRI
FOXO4-DRI is the D-retro-inverso variant of a peptide fragment of the FOXO4 transcription factor. In senescent cells, FOXO4 is bound to p53, which suppresses p53-mediated apoptosis — the cells survive in a secreting 'zombie-like' state (senescence-associated secretory phenotype, SASP). The DRI peptide disrupts this FOXO4-p53 binding, freeing p53, and the senescent cell initiates apoptosis. Healthy cells are largely unaffected because p53 is not held back by FOXO4 in them. This selectivity was the central finding of the original 2017 publication.
Base di evidenze
Evidenza più alta
RCT sull'uomo
Modello animale
Studi
4
3
di cui sull'uomo
4
0
Effetti registrati
4
3
Contraddizioni aperte
1
1
Eventi avversi documentati
4
1
Stato legale
Voci complete
Frequently asked questions
- What is the difference between Afamelanotide and FOXO4-DRI?
- Afamelanotide is classified as "Ricerca (altro)", while FOXO4-DRI is classified as "Ricerca (altro)". Afamelanotide: Afamelanotide (brand name Scenesse) is a synthetic 13-amino-acid analogue of α-melanocyte-stimulating hormone (α-MSH) and a melanocortin-1 receptor agonist. Unlike most peptides covered here, it is a regularly approved medicine: EMA approval in 2014/2015, FDA approval in 2019, in each case as a subcutaneous implant for the prevention of phototoxicity in adults with erythropoietic protoporphyria (EPP). It promotes eumelanin formation in the skin. FOXO4-DRI: Synthetic peptide with D-Retro-Inverso structure (all amino acids as D-form, sequence reversed), developed in 2017 as an experimental senolytic candidate. Goal: selective apoptosis of senescent cells via disruption of the FOXO4-p53 interaction. So far evaluated exclusively preclinically. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
- Which peptide is better supported by science, Afamelanotide or FOXO4-DRI?
- The highest available evidence level is "RCT sull'uomo" for Afamelanotide and "Modello animale" for FOXO4-DRI. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
- What is the legal status of Afamelanotide and FOXO4-DRI in Germany and the United States?
- Germania: Afamelanotide — Su prescrizione, FOXO4-DRI — Solo ricerca. Stati Uniti: Afamelanotide — Su prescrizione, FOXO4-DRI — Solo ricerca. These are factual summaries with source and review date on the individual pages.