Confronto

Amycretin vs. Lixisenatide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

nessun dato

320367-13-3

Peso molecolare

nessun dato

4858.5 g/mol

Emivita

nessun dato

3 h

Sequenza

nessun dato

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

Meccanismo d'azione

Amycretin

Amycretin activates both the GLP-1 and the amylin receptor in a single molecule. Both pathways independently suppress appetite and food intake — the combination is intended to amplify the effect beyond the GLP-1 axis alone.

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Amycretin	Lixisenatide
Germania	Non approvato	Su prescrizione
JP	—	Su prescrizione
Stati Uniti	Non approvato	Non approvato

Voci complete

Frequently asked questions

What is the difference between Amycretin and Lixisenatide?: Amycretin is classified as "Metabolico", while Lixisenatide is classified as "Metabolico". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Amycretin or Lixisenatide?: The highest available evidence level is "RCT sull'uomo" for Amycretin and "RCT sull'uomo" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Amycretin and Lixisenatide in Germany and the United States?: Germania: Amycretin — Non approvato, Lixisenatide — Su prescrizione. Stati Uniti: Amycretin — Non approvato, Lixisenatide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Amycretin

Lixisenatide

Germania

Non approvato

Su prescrizione

—

Su prescrizione

Stati Uniti

Non approvato

Frequently asked questions

What is the difference between Amycretin and Lixisenatide?

Amycretin is classified as "Metabolico", while Lixisenatide is classified as "Metabolico". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Amycretin or Lixisenatide?

The highest available evidence level is "RCT sull'uomo" for Amycretin and "RCT sull'uomo" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Amycretin and Lixisenatide in Germany and the United States?

Germania: Amycretin — Non approvato, Lixisenatide — Su prescrizione. Stati Uniti: Amycretin — Non approvato, Lixisenatide — Non approvato. These are factual summaries with source and review date on the individual pages.