Vergelijking

Amycretin vs. Lixisenatide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

geen gegevens

320367-13-3

Molecuulmassa

geen gegevens

4858.5 g/mol

Halfwaardetijd

geen gegevens

3 h

Sequentie

geen gegevens

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

Werkingsmechanisme

Amycretin

Amycretin activates both the GLP-1 and the amylin receptor in a single molecule. Both pathways independently suppress appetite and food intake — the combination is intended to amplify the effect beyond the GLP-1 axis alone.

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Amycretin	Lixisenatide
Duitsland	Niet goedgekeurd	Op recept
JP	—	Op recept
Verenigde Staten	Niet goedgekeurd	Niet goedgekeurd

Volledige vermeldingen

Amycretin

Volledige vermelding →

Lixisenatide

Volledige vermelding →

Frequently asked questions

What is the difference between Amycretin and Lixisenatide?: Amycretin is classified as "Metabool", while Lixisenatide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Amycretin or Lixisenatide?: The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Amycretin and Lixisenatide in Germany and the United States?: Duitsland: Amycretin — Niet goedgekeurd, Lixisenatide — Op recept. Verenigde Staten: Amycretin — Niet goedgekeurd, Lixisenatide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Amycretin

Lixisenatide

Duitsland

Niet goedgekeurd

Op recept

—

Op recept

Verenigde Staten

Niet goedgekeurd

Frequently asked questions

What is the difference between Amycretin and Lixisenatide?

Amycretin is classified as "Metabool", while Lixisenatide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Amycretin or Lixisenatide?

The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Amycretin and Lixisenatide in Germany and the United States?

Duitsland: Amycretin — Niet goedgekeurd, Lixisenatide — Op recept. Verenigde Staten: Amycretin — Niet goedgekeurd, Lixisenatide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.