Confronto

Buserelin vs. LL-37

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Ricerca (altro)

N. CAS

57982-77-1

597562-32-8

Peso molecolare

1239.42 g/mol

4493.33 g/mol

Emivita

nessun dato

Sequenza

nessun dato

[LL-37, 37 aa]

Meccanismo d'azione

Buserelin

Buserelin is a potent GnRH agonist: after an initial stimulatory surge ('flare'), continuous receptor occupancy causes downregulation and thereby suppression of LH, FSH and the downstream sex hormones.

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Buserelin	LL-37
Germania	Su prescrizione	Solo ricerca
Stati Uniti	Non approvato	Solo ricerca

Voci complete

Frequently asked questions

What is the difference between Buserelin and LL-37?: Buserelin is classified as "Ricerca (altro)", while LL-37 is classified as "Ricerca (altro)". Buserelin: Buserelin is a synthetic GnRH agonist (including as a nasal spray). It is used in endometriosis, hormone-dependent prostate cancer and assisted reproduction; approved in Europe (Suprefact), not in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Buserelin or LL-37?: The highest available evidence level is "RCT sull'uomo" for Buserelin and "Studio sull'uomo" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Buserelin and LL-37 in Germany and the United States?: Germania: Buserelin — Su prescrizione, LL-37 — Solo ricerca. Stati Uniti: Buserelin — Non approvato, LL-37 — Solo ricerca. These are factual summaries with source and review date on the individual pages.

Country

Buserelin

LL-37

Germania

Su prescrizione

Solo ricerca

Stati Uniti

Non approvato

Solo ricerca

Frequently asked questions

What is the difference between Buserelin and LL-37?

Buserelin is classified as "Ricerca (altro)", while LL-37 is classified as "Ricerca (altro)". Buserelin: Buserelin is a synthetic GnRH agonist (including as a nasal spray). It is used in endometriosis, hormone-dependent prostate cancer and assisted reproduction; approved in Europe (Suprefact), not in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Buserelin or LL-37?

The highest available evidence level is "RCT sull'uomo" for Buserelin and "Studio sull'uomo" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Buserelin and LL-37 in Germany and the United States?

Germania: Buserelin — Su prescrizione, LL-37 — Solo ricerca. Stati Uniti: Buserelin — Non approvato, LL-37 — Solo ricerca. These are factual summaries with source and review date on the individual pages.