Vergelijking

Buserelin vs. LL-37

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Onderzoek (overig)

CAS-nr.

57982-77-1

597562-32-8

Molecuulmassa

1239.42 g/mol

4493.33 g/mol

Halfwaardetijd

geen gegevens

Sequentie

geen gegevens

[LL-37, 37 aa]

Werkingsmechanisme

Buserelin

Buserelin is a potent GnRH agonist: after an initial stimulatory surge ('flare'), continuous receptor occupancy causes downregulation and thereby suppression of LH, FSH and the downstream sex hormones.

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Bewijsbasis

Hoogste bewijs

Humane RCT

Humane studie

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Buserelin	LL-37
Duitsland	Op recept	Alleen onderzoek
Verenigde Staten	Niet goedgekeurd	Alleen onderzoek

Volledige vermeldingen

Buserelin

Volledige vermelding →

LL-37

Volledige vermelding →

Frequently asked questions

What is the difference between Buserelin and LL-37?: Buserelin is classified as "Onderzoek (overig)", while LL-37 is classified as "Onderzoek (overig)". Buserelin: Buserelin is a synthetic GnRH agonist (including as a nasal spray). It is used in endometriosis, hormone-dependent prostate cancer and assisted reproduction; approved in Europe (Suprefact), not in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Buserelin or LL-37?: The highest available evidence level is "Humane RCT" for Buserelin and "Humane studie" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Buserelin and LL-37 in Germany and the United States?: Duitsland: Buserelin — Op recept, LL-37 — Alleen onderzoek. Verenigde Staten: Buserelin — Niet goedgekeurd, LL-37 — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.

Country

Buserelin

LL-37

Duitsland

Op recept

Alleen onderzoek

Verenigde Staten

Niet goedgekeurd

Alleen onderzoek

Frequently asked questions

What is the difference between Buserelin and LL-37?

Buserelin is classified as "Onderzoek (overig)", while LL-37 is classified as "Onderzoek (overig)". Buserelin: Buserelin is a synthetic GnRH agonist (including as a nasal spray). It is used in endometriosis, hormone-dependent prostate cancer and assisted reproduction; approved in Europe (Suprefact), not in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Buserelin or LL-37?

The highest available evidence level is "Humane RCT" for Buserelin and "Humane studie" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Buserelin and LL-37 in Germany and the United States?

Duitsland: Buserelin — Op recept, LL-37 — Alleen onderzoek. Verenigde Staten: Buserelin — Niet goedgekeurd, LL-37 — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.