Confronto

Cagrilintide vs. Lixisenatide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

1415456-99-3

320367-13-3

Peso molecolare

4253.7 g/mol

4858.5 g/mol

Emivita

168 h

3 h

Sequenza

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

Meccanismo d'azione

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Cagrilintide	Lixisenatide
Germania	Non approvato	Su prescrizione
DK	Non approvato	—
JP	—	Su prescrizione
Stati Uniti	Non approvato	Non approvato

Voci complete

Frequently asked questions

What is the difference between Cagrilintide and Lixisenatide?: Cagrilintide is classified as "Metabolico", while Lixisenatide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Lixisenatide?: The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Lixisenatide in Germany and the United States?: Germania: Cagrilintide — Non approvato, Lixisenatide — Su prescrizione. Stati Uniti: Cagrilintide — Non approvato, Lixisenatide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Lixisenatide

Germania

Non approvato

Su prescrizione

Non approvato

—

Su prescrizione

Stati Uniti

Non approvato

Frequently asked questions

What is the difference between Cagrilintide and Lixisenatide?

Cagrilintide is classified as "Metabolico", while Lixisenatide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Lixisenatide?

The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "RCT sull'uomo" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Lixisenatide in Germany and the United States?

Germania: Cagrilintide — Non approvato, Lixisenatide — Su prescrizione. Stati Uniti: Cagrilintide — Non approvato, Lixisenatide — Non approvato. These are factual summaries with source and review date on the individual pages.