Confronto

Cagrilintide vs. Pemvidutide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

1415456-99-3

nessun dato

Peso molecolare

4253.7 g/mol

nessun dato

Emivita

168 h

nessun dato

Sequenza

KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY

nessun dato

Meccanismo d'azione

Cagrilintide

Cagrilintide binds amylin receptors (AMY1, AMY3, formed by the calcitonin receptor plus RAMP proteins). Activation delays gastric emptying, inhibits postprandial glucagon secretion and modulates central satiety signalling via area postrema neurons. An acyl modification enables albumin binding and thereby weekly dosing.

Pemvidutide

The GLP-1 component suppresses appetite while the glucagon component raises energy expenditure and acts directly on hepatic fat metabolism — the combination is intended to mimic the complementary effects of diet and exercise.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Cagrilintide	Pemvidutide
Germania	Non approvato	Non approvato
DK	Non approvato	—
Stati Uniti	Non approvato	Non approvato

Voci complete

Frequently asked questions

What is the difference between Cagrilintide and Pemvidutide?: Cagrilintide is classified as "Metabolico", while Pemvidutide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Pemvidutide: Pemvidutide is a 29-amino-acid GLP-1/glucagon dual receptor agonist (Altimmune) under investigation for obesity and the fatty-liver disease MASH. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Cagrilintide or Pemvidutide?: The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "Studio sull'uomo" for Pemvidutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Cagrilintide and Pemvidutide in Germany and the United States?: Germania: Cagrilintide — Non approvato, Pemvidutide — Non approvato. Stati Uniti: Cagrilintide — Non approvato, Pemvidutide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Cagrilintide

Pemvidutide

Germania

Non approvato

—

Stati Uniti

Non approvato

Frequently asked questions

What is the difference between Cagrilintide and Pemvidutide?

Cagrilintide is classified as "Metabolico", while Pemvidutide is classified as "Metabolico". Cagrilintide: Synthetic long-acting amylin analog being developed in combination with semaglutide (CagriSema). Phase 3 trials for obesity and type 2 diabetes are ongoing. No marketing approval yet. Pemvidutide: Pemvidutide is a 29-amino-acid GLP-1/glucagon dual receptor agonist (Altimmune) under investigation for obesity and the fatty-liver disease MASH. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Cagrilintide or Pemvidutide?

The highest available evidence level is "RCT sull'uomo" for Cagrilintide and "Studio sull'uomo" for Pemvidutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Cagrilintide and Pemvidutide in Germany and the United States?

Germania: Cagrilintide — Non approvato, Pemvidutide — Non approvato. Stati Uniti: Cagrilintide — Non approvato, Pemvidutide — Non approvato. These are factual summaries with source and review date on the individual pages.