Confronto

Carbetocin vs. LL-37

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Ricerca (altro)

N. CAS

37025-55-1

597562-32-8

Peso molecolare

nessun dato

4493.33 g/mol

Emivita

0.67 h

nessun dato

Sequenza

nessun dato

[LL-37, 37 aa]

Meccanismo d'azione

Carbetocin

Carbetocin is an oxytocin receptor agonist with prolonged duration. It triggers a sustained contraction of the uterus after birth, preventing atonic hemorrhage — unlike oxytocin, without a multi-hour infusion.

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Carbetocin	LL-37
Germania	Su prescrizione	Solo ricerca
Stati Uniti	Non approvato	Solo ricerca

Voci complete

Frequently asked questions

What is the difference between Carbetocin and LL-37?: Carbetocin is classified as "Ricerca (altro)", while LL-37 is classified as "Ricerca (altro)". Carbetocin: Carbetocin is a long-acting synthetic oxytocin analog (half-life ~40 minutes). It prevents postpartum hemorrhage as a single injection. Approved in Canada and the UK among others, NOT in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Carbetocin or LL-37?: The highest available evidence level is "RCT sull'uomo" for Carbetocin and "Studio sull'uomo" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Carbetocin and LL-37 in Germany and the United States?: Germania: Carbetocin — Su prescrizione, LL-37 — Solo ricerca. Stati Uniti: Carbetocin — Non approvato, LL-37 — Solo ricerca. These are factual summaries with source and review date on the individual pages.

Country

Carbetocin

LL-37

Germania

Su prescrizione

Solo ricerca

Stati Uniti

Non approvato

Solo ricerca

Frequently asked questions

What is the difference between Carbetocin and LL-37?

Carbetocin is classified as "Ricerca (altro)", while LL-37 is classified as "Ricerca (altro)". Carbetocin: Carbetocin is a long-acting synthetic oxytocin analog (half-life ~40 minutes). It prevents postpartum hemorrhage as a single injection. Approved in Canada and the UK among others, NOT in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Carbetocin or LL-37?

The highest available evidence level is "RCT sull'uomo" for Carbetocin and "Studio sull'uomo" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Carbetocin and LL-37 in Germany and the United States?

Germania: Carbetocin — Su prescrizione, LL-37 — Solo ricerca. Stati Uniti: Carbetocin — Non approvato, LL-37 — Solo ricerca. These are factual summaries with source and review date on the individual pages.