Vergelijking

Carbetocin vs. LL-37

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Onderzoek (overig)

CAS-nr.

37025-55-1

597562-32-8

Molecuulmassa

geen gegevens

4493.33 g/mol

Halfwaardetijd

0.67 h

geen gegevens

Sequentie

geen gegevens

[LL-37, 37 aa]

Werkingsmechanisme

Carbetocin

Carbetocin is an oxytocin receptor agonist with prolonged duration. It triggers a sustained contraction of the uterus after birth, preventing atonic hemorrhage — unlike oxytocin, without a multi-hour infusion.

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Bewijsbasis

Hoogste bewijs

Humane RCT

Humane studie

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Carbetocin	LL-37
Duitsland	Op recept	Alleen onderzoek
Verenigde Staten	Niet goedgekeurd	Alleen onderzoek

Volledige vermeldingen

Carbetocin

Volledige vermelding →

LL-37

Volledige vermelding →

Frequently asked questions

What is the difference between Carbetocin and LL-37?: Carbetocin is classified as "Onderzoek (overig)", while LL-37 is classified as "Onderzoek (overig)". Carbetocin: Carbetocin is a long-acting synthetic oxytocin analog (half-life ~40 minutes). It prevents postpartum hemorrhage as a single injection. Approved in Canada and the UK among others, NOT in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Carbetocin or LL-37?: The highest available evidence level is "Humane RCT" for Carbetocin and "Humane studie" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Carbetocin and LL-37 in Germany and the United States?: Duitsland: Carbetocin — Op recept, LL-37 — Alleen onderzoek. Verenigde Staten: Carbetocin — Niet goedgekeurd, LL-37 — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.

Country

Carbetocin

LL-37

Duitsland

Op recept

Alleen onderzoek

Verenigde Staten

Niet goedgekeurd

Alleen onderzoek

Frequently asked questions

What is the difference between Carbetocin and LL-37?

Carbetocin is classified as "Onderzoek (overig)", while LL-37 is classified as "Onderzoek (overig)". Carbetocin: Carbetocin is a long-acting synthetic oxytocin analog (half-life ~40 minutes). It prevents postpartum hemorrhage as a single injection. Approved in Canada and the UK among others, NOT in the US. LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Carbetocin or LL-37?

The highest available evidence level is "Humane RCT" for Carbetocin and "Humane studie" for LL-37. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Carbetocin and LL-37 in Germany and the United States?

Duitsland: Carbetocin — Op recept, LL-37 — Alleen onderzoek. Verenigde Staten: Carbetocin — Niet goedgekeurd, LL-37 — Alleen onderzoek. These are factual summaries with source and review date on the individual pages.