Confronto

Liraglutide vs. Pemvidutide

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

204656-20-2

nessun dato

Peso molecolare

3751 g/mol

nessun dato

Emivita

13 h

nessun dato

Sequenza

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

nessun dato

Meccanismo d'azione

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Pemvidutide

The GLP-1 component suppresses appetite while the glucagon component raises energy expenditure and acts directly on hepatic fat metabolism — the combination is intended to mimic the complementary effects of diet and exercise.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Liraglutide	Pemvidutide
Germania	Su prescrizione	Non approvato
Stati Uniti	Su prescrizione	Non approvato

Voci complete

Frequently asked questions

What is the difference between Liraglutide and Pemvidutide?: Liraglutide is classified as "Metabolico", while Pemvidutide is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Pemvidutide: Pemvidutide is a 29-amino-acid GLP-1/glucagon dual receptor agonist (Altimmune) under investigation for obesity and the fatty-liver disease MASH. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Pemvidutide?: The highest available evidence level is "RCT sull'uomo" for Liraglutide and "Studio sull'uomo" for Pemvidutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Pemvidutide in Germany and the United States?: Germania: Liraglutide — Su prescrizione, Pemvidutide — Non approvato. Stati Uniti: Liraglutide — Su prescrizione, Pemvidutide — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Pemvidutide

Germania

Su prescrizione

Non approvato

Stati Uniti

Su prescrizione

Non approvato

Frequently asked questions

What is the difference between Liraglutide and Pemvidutide?

Liraglutide is classified as "Metabolico", while Pemvidutide is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Pemvidutide: Pemvidutide is a 29-amino-acid GLP-1/glucagon dual receptor agonist (Altimmune) under investigation for obesity and the fatty-liver disease MASH. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Pemvidutide?

The highest available evidence level is "RCT sull'uomo" for Liraglutide and "Studio sull'uomo" for Pemvidutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Pemvidutide in Germany and the United States?

Germania: Liraglutide — Su prescrizione, Pemvidutide — Non approvato. Stati Uniti: Liraglutide — Su prescrizione, Pemvidutide — Non approvato. These are factual summaries with source and review date on the individual pages.