Confronto

Liraglutide vs. Semaglutid

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

204656-20-2

910463-68-2

Peso molecolare

3751 g/mol

4113.6 g/mol

Emivita

13 h

165 h

Sequenza

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

modifiziertes GLP-1-Analogon (31 AS) mit C18-Fettsäure-Linker

Meccanismo d'azione

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Semaglutid

Long-acting agonist at the GLP-1 receptor. Structurally a modified glucagon-like peptide 1 whose long half-life is achieved via a fatty-acid side chain and reversible albumin binding. Acts centrally on satiety and peripherally on glucose-dependent insulin secretion and delayed gastric emptying.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Liraglutide	Semaglutid
Svizzera	—	Su prescrizione
Germania	Su prescrizione	Su prescrizione
Stati Uniti	Su prescrizione	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between Liraglutide and Semaglutid?: Liraglutide is classified as "Metabolico", while Semaglutid is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Semaglutid?: The highest available evidence level is "RCT sull'uomo" for Liraglutide and "RCT sull'uomo" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Semaglutid in Germany and the United States?: Germania: Liraglutide — Su prescrizione, Semaglutid — Su prescrizione. Stati Uniti: Liraglutide — Su prescrizione, Semaglutid — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Semaglutid

Svizzera

—

Su prescrizione

Germania

Su prescrizione

Stati Uniti

Su prescrizione

Frequently asked questions

What is the difference between Liraglutide and Semaglutid?

Liraglutide is classified as "Metabolico", while Semaglutid is classified as "Metabolico". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Semaglutid?

The highest available evidence level is "RCT sull'uomo" for Liraglutide and "RCT sull'uomo" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Semaglutid in Germany and the United States?

Germania: Liraglutide — Su prescrizione, Semaglutid — Su prescrizione. Stati Uniti: Liraglutide — Su prescrizione, Semaglutid — Su prescrizione. These are factual summaries with source and review date on the individual pages.