Vergelijking

Liraglutide vs. Semaglutid

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

204656-20-2

910463-68-2

Molecuulmassa

3751 g/mol

4113.6 g/mol

Halfwaardetijd

13 h

165 h

Sequentie

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

modifiziertes GLP-1-Analogon (31 AS) mit C18-Fettsäure-Linker

Werkingsmechanisme

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Semaglutid

Long-acting agonist at the GLP-1 receptor. Structurally a modified glucagon-like peptide 1 whose long half-life is achieved via a fatty-acid side chain and reversible albumin binding. Acts centrally on satiety and peripherally on glucose-dependent insulin secretion and delayed gastric emptying.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Liraglutide	Semaglutid
Zwitserland	—	Op recept
Duitsland	Op recept	Op recept
Verenigde Staten	Op recept	Op recept

Volledige vermeldingen

Liraglutide

Volledige vermelding →

Semaglutid

Volledige vermelding →

Frequently asked questions

What is the difference between Liraglutide and Semaglutid?: Liraglutide is classified as "Metabool", while Semaglutid is classified as "Metabool". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Liraglutide or Semaglutid?: The highest available evidence level is "Humane RCT" for Liraglutide and "Humane RCT" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Liraglutide and Semaglutid in Germany and the United States?: Duitsland: Liraglutide — Op recept, Semaglutid — Op recept. Verenigde Staten: Liraglutide — Op recept, Semaglutid — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Liraglutide

Semaglutid

Zwitserland

—

Op recept

Duitsland

Op recept

Verenigde Staten

Op recept

Frequently asked questions

What is the difference between Liraglutide and Semaglutid?

Liraglutide is classified as "Metabool", while Semaglutid is classified as "Metabool". Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). Semaglutid: Long-acting GLP-1 receptor agonist. Approved as a medicinal product for type-2 diabetes (Ozempic, Rybelsus), chronic weight management (Wegovy) and cardiovascular risk in obesity. One of the best-studied substances on this platform — many large human RCTs. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Liraglutide or Semaglutid?

The highest available evidence level is "Humane RCT" for Liraglutide and "Humane RCT" for Semaglutid. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Liraglutide and Semaglutid in Germany and the United States?

Duitsland: Liraglutide — Op recept, Semaglutid — Op recept. Verenigde Staten: Liraglutide — Op recept, Semaglutid — Op recept. These are factual summaries with source and review date on the individual pages.