Confronto

Lixisenatide vs. VK2735

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Metabolico

N. CAS

320367-13-3

nessun dato

Peso molecolare

4858.5 g/mol

nessun dato

Emivita

3 h

nessun dato

Sequenza

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

nessun dato

Meccanismo d'azione

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

VK2735

VK2735 activates both the GLP-1 and the GIP receptor — a dual mechanism similar to that of tirzepatide, suppressing appetite and food intake.

Base di evidenze

Evidenza più alta

RCT sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	Lixisenatide	VK2735
Germania	Su prescrizione	Non approvato
JP	Su prescrizione	—
Stati Uniti	Non approvato	Non approvato

Voci complete

Frequently asked questions

What is the difference between Lixisenatide and VK2735?: Lixisenatide is classified as "Metabolico", while VK2735 is classified as "Metabolico". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Lixisenatide or VK2735?: The highest available evidence level is "RCT sull'uomo" for Lixisenatide and "RCT sull'uomo" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Lixisenatide and VK2735 in Germany and the United States?: Germania: Lixisenatide — Su prescrizione, VK2735 — Non approvato. Stati Uniti: Lixisenatide — Non approvato, VK2735 — Non approvato. These are factual summaries with source and review date on the individual pages.

Country

Lixisenatide

VK2735

Germania

Su prescrizione

Non approvato

Su prescrizione

—

Stati Uniti

Non approvato

Frequently asked questions

What is the difference between Lixisenatide and VK2735?

Lixisenatide is classified as "Metabolico", while VK2735 is classified as "Metabolico". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Lixisenatide or VK2735?

The highest available evidence level is "RCT sull'uomo" for Lixisenatide and "RCT sull'uomo" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Lixisenatide and VK2735 in Germany and the United States?

Germania: Lixisenatide — Su prescrizione, VK2735 — Non approvato. Stati Uniti: Lixisenatide — Non approvato, VK2735 — Non approvato. These are factual summaries with source and review date on the individual pages.