Vergelijking

Lixisenatide vs. VK2735

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

320367-13-3

geen gegevens

Molecuulmassa

4858.5 g/mol

geen gegevens

Halfwaardetijd

3 h

geen gegevens

Sequentie

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

geen gegevens

Werkingsmechanisme

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

VK2735

VK2735 activates both the GLP-1 and the GIP receptor — a dual mechanism similar to that of tirzepatide, suppressing appetite and food intake.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Lixisenatide	VK2735
Duitsland	Op recept	Niet goedgekeurd
JP	Op recept	—
Verenigde Staten	Niet goedgekeurd	Niet goedgekeurd

Volledige vermeldingen

Lixisenatide

Volledige vermelding →

VK2735

Volledige vermelding →

Frequently asked questions

What is the difference between Lixisenatide and VK2735?: Lixisenatide is classified as "Metabool", while VK2735 is classified as "Metabool". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Lixisenatide or VK2735?: The highest available evidence level is "Humane RCT" for Lixisenatide and "Humane RCT" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Lixisenatide and VK2735 in Germany and the United States?: Duitsland: Lixisenatide — Op recept, VK2735 — Niet goedgekeurd. Verenigde Staten: Lixisenatide — Niet goedgekeurd, VK2735 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

Lixisenatide

VK2735

Duitsland

Op recept

Niet goedgekeurd

Op recept

—

Verenigde Staten

Niet goedgekeurd

Frequently asked questions

What is the difference between Lixisenatide and VK2735?

Lixisenatide is classified as "Metabool", while VK2735 is classified as "Metabool". Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. VK2735: VK2735 is a dual GLP-1/GIP receptor agonist from Viking Therapeutics, in development in both subcutaneous and oral forms for obesity. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Lixisenatide or VK2735?

The highest available evidence level is "Humane RCT" for Lixisenatide and "Humane RCT" for VK2735. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Lixisenatide and VK2735 in Germany and the United States?

Duitsland: Lixisenatide — Op recept, VK2735 — Niet goedgekeurd. Verenigde Staten: Lixisenatide — Niet goedgekeurd, VK2735 — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.