Confronto

LL-37 vs. Sekretin

Due peptidi a confronto — identità, base di evidenze, stato legale ed eventi avversi noti.

Identità

Categoria

Ricerca (altro)

N. CAS

597562-32-8

nessun dato

Peso molecolare

4493.33 g/mol

3055.5 g/mol

Emivita

nessun dato

Sequenza

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

nessun dato

Meccanismo d'azione

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Sekretin

Secretin binds the Gs-coupled secretin receptor (SCTR) on pancreatic duct cells, opens CFTR chloride channels and triggers secretion of bicarbonate-rich pancreatic fluid and bile flow.

Base di evidenze

Evidenza più alta

Studio sull'uomo

Studi

di cui sull'uomo

Effetti registrati

Contraddizioni aperte

Eventi avversi documentati

Stato legale

Country	LL-37	Sekretin
Germania	Solo ricerca	Su prescrizione
Stati Uniti	Solo ricerca	Su prescrizione

Voci complete

Frequently asked questions

What is the difference between LL-37 and Sekretin?: LL-37 is classified as "Ricerca (altro)", while Sekretin is classified as "Ricerca (altro)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sekretin: Secretin is a 27-amino-acid hormone that regulates pancreatic bicarbonate secretion. As ChiRhoStim it is FDA-approved as a diagnostic agent (pancreatic function test, gastrinoma test, secretin-enhanced MRCP). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, LL-37 or Sekretin?: The highest available evidence level is "Studio sull'uomo" for LL-37 and "Studio sull'uomo" for Sekretin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of LL-37 and Sekretin in Germany and the United States?: Germania: LL-37 — Solo ricerca, Sekretin — Su prescrizione. Stati Uniti: LL-37 — Solo ricerca, Sekretin — Su prescrizione. These are factual summaries with source and review date on the individual pages.

Country

LL-37

Sekretin

Germania

Solo ricerca

Su prescrizione

Stati Uniti

Solo ricerca

Su prescrizione

Frequently asked questions

What is the difference between LL-37 and Sekretin?

LL-37 is classified as "Ricerca (altro)", while Sekretin is classified as "Ricerca (altro)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sekretin: Secretin is a 27-amino-acid hormone that regulates pancreatic bicarbonate secretion. As ChiRhoStim it is FDA-approved as a diagnostic agent (pancreatic function test, gastrinoma test, secretin-enhanced MRCP). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, LL-37 or Sekretin?

The highest available evidence level is "Studio sull'uomo" for LL-37 and "Studio sull'uomo" for Sekretin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of LL-37 and Sekretin in Germany and the United States?

Germania: LL-37 — Solo ricerca, Sekretin — Su prescrizione. Stati Uniti: LL-37 — Solo ricerca, Sekretin — Su prescrizione. These are factual summaries with source and review date on the individual pages.