Vergelijking

LL-37 vs. Sekretin

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Onderzoek (overig)

CAS-nr.

597562-32-8

geen gegevens

Molecuulmassa

4493.33 g/mol

3055.5 g/mol

Halfwaardetijd

geen gegevens

Sequentie

[LL-37, 37 aa]

geen gegevens

Werkingsmechanisme

LL-37

LL-37 is a cationic, amphipathic helical peptide and the only member of the cathelicidin family in humans. It is generated by proteolytic cleavage from the C-terminal portion of the precursor protein hCAP18 (CAP-18). Mechanistically it associates with and can permeabilize microbial membranes; in addition it modulates immune cells, influences cytokine release, exerts chemotactic activity, and can bind extracellular self-DNA. Preclinical models have described both anti-inflammatory and pro-inflammatory effects, depending on concentration and tissue context.

Sekretin

Secretin binds the Gs-coupled secretin receptor (SCTR) on pancreatic duct cells, opens CFTR chloride channels and triggers secretion of bicarbonate-rich pancreatic fluid and bile flow.

Bewijsbasis

Hoogste bewijs

Humane studie

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	LL-37	Sekretin
Duitsland	Alleen onderzoek	Op recept
Verenigde Staten	Alleen onderzoek	Op recept

Volledige vermeldingen

LL-37

Volledige vermelding →

Sekretin

Volledige vermelding →

Frequently asked questions

What is the difference between LL-37 and Sekretin?: LL-37 is classified as "Onderzoek (overig)", while Sekretin is classified as "Onderzoek (overig)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sekretin: Secretin is a 27-amino-acid hormone that regulates pancreatic bicarbonate secretion. As ChiRhoStim it is FDA-approved as a diagnostic agent (pancreatic function test, gastrinoma test, secretin-enhanced MRCP). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, LL-37 or Sekretin?: The highest available evidence level is "Humane studie" for LL-37 and "Humane studie" for Sekretin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of LL-37 and Sekretin in Germany and the United States?: Duitsland: LL-37 — Alleen onderzoek, Sekretin — Op recept. Verenigde Staten: LL-37 — Alleen onderzoek, Sekretin — Op recept. These are factual summaries with source and review date on the individual pages.

Country

LL-37

Sekretin

Duitsland

Alleen onderzoek

Op recept

Verenigde Staten

Alleen onderzoek

Op recept

Frequently asked questions

What is the difference between LL-37 and Sekretin?

LL-37 is classified as "Onderzoek (overig)", while Sekretin is classified as "Onderzoek (overig)". LL-37: LL-37 is the only known human cathelicidin, a 37-amino-acid antimicrobial peptide generated by cleavage of the precursor protein hCAP18. In research it plays a central role in innate immune defence and wound healing, yet acts in a context-dependent manner as both anti- and pro-inflammatory and has been linked to autoimmune processes. LL-37 is not an approved drug; the evidence base is predominantly basic and preclinical. Sekretin: Secretin is a 27-amino-acid hormone that regulates pancreatic bicarbonate secretion. As ChiRhoStim it is FDA-approved as a diagnostic agent (pancreatic function test, gastrinoma test, secretin-enhanced MRCP). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, LL-37 or Sekretin?

The highest available evidence level is "Humane studie" for LL-37 and "Humane studie" for Sekretin. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of LL-37 and Sekretin in Germany and the United States?

Duitsland: LL-37 — Alleen onderzoek, Sekretin — Op recept. Verenigde Staten: LL-37 — Alleen onderzoek, Sekretin — Op recept. These are factual summaries with source and review date on the individual pages.