Vergelijking

Amycretin vs. Liraglutide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

geen gegevens

204656-20-2

Molecuulmassa

geen gegevens

3751 g/mol

Halfwaardetijd

geen gegevens

13 h

Sequentie

geen gegevens

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

Werkingsmechanisme

Amycretin

Amycretin activates both the GLP-1 and the amylin receptor in a single molecule. Both pathways independently suppress appetite and food intake — the combination is intended to amplify the effect beyond the GLP-1 axis alone.

Liraglutide

Liraglutide is a synthetic GLP-1 analog with 97% sequence identity to human GLP-1. A fatty-acid side chain (C16) on Lys-26 reversibly binds serum albumin and protects against DPP-4 degradation. GLP-1 receptor activation glucose-dependently stimulates insulin secretion, inhibits glucagon secretion, delays gastric emptying and modulates central satiety.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	Amycretin	Liraglutide
Duitsland	Niet goedgekeurd	Op recept
Verenigde Staten	Niet goedgekeurd	Op recept

Volledige vermeldingen

Amycretin

Volledige vermelding →

Liraglutide

Volledige vermelding →

Frequently asked questions

What is the difference between Amycretin and Liraglutide?: Amycretin is classified as "Metabool", while Liraglutide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, Amycretin or Liraglutide?: The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Liraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of Amycretin and Liraglutide in Germany and the United States?: Duitsland: Amycretin — Niet goedgekeurd, Liraglutide — Op recept. Verenigde Staten: Amycretin — Niet goedgekeurd, Liraglutide — Op recept. These are factual summaries with source and review date on the individual pages.

Country

Amycretin

Liraglutide

Duitsland

Niet goedgekeurd

Op recept

Verenigde Staten

Niet goedgekeurd

Op recept

Frequently asked questions

What is the difference between Amycretin and Liraglutide?

Amycretin is classified as "Metabool", while Liraglutide is classified as "Metabool". Amycretin: Amycretin is a unimolecular GLP-1 and amylin receptor agonist from Novo Nordisk — in development both as a once-weekly subcutaneous and a once-daily oral form for obesity and type 2 diabetes. Liraglutide: GLP-1 receptor agonist with a half-life of about 13 hours. The first daily (not weekly) modern GLP-1 RA — approved as Victoza for type 2 diabetes (2010) and Saxenda for obesity (2014). This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, Amycretin or Liraglutide?

The highest available evidence level is "Humane RCT" for Amycretin and "Humane RCT" for Liraglutide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of Amycretin and Liraglutide in Germany and the United States?

Duitsland: Amycretin — Niet goedgekeurd, Liraglutide — Op recept. Verenigde Staten: Amycretin — Niet goedgekeurd, Liraglutide — Op recept. These are factual summaries with source and review date on the individual pages.