Vergelijking

CagriSema vs. Lixisenatide

Twee peptiden naast elkaar — identiteit, bewijsbasis, juridische status en bekende bijwerkingen.

Identiteit

Categorie

Metabool

CAS-nr.

geen gegevens

320367-13-3

Molecuulmassa

geen gegevens

4858.5 g/mol

Halfwaardetijd

geen gegevens

3 h

Sequentie

geen gegevens

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2

Werkingsmechanisme

CagriSema

CagriSema combines two satiety pathways in one weekly injection: the amylin analogue cagrilintide and the GLP-1 agonist semaglutide. Both suppress appetite and food intake — together more than either component alone.

Lixisenatide

Lixisenatide is a 44-amino-acid peptide based on exendin-4 (see exenatide) with six additional lysine residues at the C-terminus. This modification increases stability against DPP-4 degradation. The short half-life (~3 hours) and plasma peak around mealtime explain the predominantly prandial effect — stronger postprandial glucose action, weaker fasting glucose effect than weekly GLP-1 RAs.

Bewijsbasis

Hoogste bewijs

Humane RCT

Studies

waarvan bij mensen

Geregistreerde effecten

Openstaande tegenstrijdigheden

Gedocumenteerde bijwerkingen

Juridische status

Country	CagriSema	Lixisenatide
Duitsland	Niet goedgekeurd	Op recept
JP	—	Op recept
Verenigde Staten	Niet goedgekeurd	Niet goedgekeurd

Volledige vermeldingen

CagriSema

Volledige vermelding →

Lixisenatide

Volledige vermelding →

Frequently asked questions

What is the difference between CagriSema and Lixisenatide?: CagriSema is classified as "Metabool", while Lixisenatide is classified as "Metabool". CagriSema: CagriSema is a fixed-dose combination of the amylin analogue cagrilintide and the GLP-1 agonist semaglutide (Novo Nordisk), in late-stage development for obesity and type 2 diabetes. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.
Which peptide is better supported by science, CagriSema or Lixisenatide?: The highest available evidence level is "Humane RCT" for CagriSema and "Humane RCT" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.
What is the legal status of CagriSema and Lixisenatide in Germany and the United States?: Duitsland: CagriSema — Niet goedgekeurd, Lixisenatide — Op recept. Verenigde Staten: CagriSema — Niet goedgekeurd, Lixisenatide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.

Country

CagriSema

Lixisenatide

Duitsland

Niet goedgekeurd

Op recept

—

Op recept

Verenigde Staten

Niet goedgekeurd

Frequently asked questions

What is the difference between CagriSema and Lixisenatide?

CagriSema is classified as "Metabool", while Lixisenatide is classified as "Metabool". CagriSema: CagriSema is a fixed-dose combination of the amylin analogue cagrilintide and the GLP-1 agonist semaglutide (Novo Nordisk), in late-stage development for obesity and type 2 diabetes. Lixisenatide: Synthetic exendin-4 analog with a C-terminal lysine extension. Prandial GLP-1 RA focused on postprandial glucose. FDA-approved 2016 as Adlyxin; EMA-approved 2013 as Lyxumia. Sanofi discontinued US distribution in 2023. This page contrasts both neutrally and source-based — with no usage or dosing recommendation.

Which peptide is better supported by science, CagriSema or Lixisenatide?

The highest available evidence level is "Humane RCT" for CagriSema and "Humane RCT" for Lixisenatide. A higher evidence level means more robust data, but says nothing about suitability for an individual. The full body of evidence is on each peptide's own page.

What is the legal status of CagriSema and Lixisenatide in Germany and the United States?

Duitsland: CagriSema — Niet goedgekeurd, Lixisenatide — Op recept. Verenigde Staten: CagriSema — Niet goedgekeurd, Lixisenatide — Niet goedgekeurd. These are factual summaries with source and review date on the individual pages.